KEGG   Falco cherrug (Saker falcon): 102053424Help
Entry
102053424         CDS       T02911                                 

Definition
(RefSeq) NADH-cytochrome b5 reductase 2
  KO
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    102053424
Enzymes [BR:fch01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     102053424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 261 aa AA seqDB search
MEGALRIVNTEEISHDTKKFRFGLPSPDHVLGLPVGQHVYLSAKIDGNLVIRAYTPVSSD
ETKGYVDLIIKVYHKNVNPKFPEGGKMSQYLDDMKIGDIIDFRGPNGLLVYKGAGTFLIK
PHKKSEAEKKVAKHLGMIAGGTGITPMLQLIRRITNDPKDSTKCYLLFANQTEKDILLRD
ELEDIAKRHPDQFVLWYTLDRPPQDWKYSSGFITADMIKNHLPSPGSETLILMCGPPPMI
QFACQPNLDTLGYPKSSTFSY
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggaaggagcgttaagaatagttaatacagaggaaatcagtcacgatactaagaaattc
cgatttgggctgccttcaccagatcatgtattagggttacctgtaggccaacatgtttat
ctttctgcaaaaatcgatggtaatctggtgattcgagcctatacccccgtttccagtgat
gagacaaaaggttatgttgatttaattataaaggtgtaccacaaaaatgtgaatcccaag
tttccagaaggtggaaagatgtcccagtacctagacgatatgaagattggagatattatt
gatttcagagggccaaatgggctccttgtctataagggagcaggtacttttcttatcaag
cctcataagaagtctgaagcagagaagaaggttgcaaagcatcttgggatgatagctgga
ggaacaggaataactcctatgttgcagctgattcgtcgtatcacaaatgatcctaaggac
tccacaaaatgttaccttctttttgctaatcagacagaaaaagatatattactgagagat
gagctcgaagacattgcgaagaggcatcctgatcagttcgtgctttggtatacactggac
agacctccacaagattggaagtacagttctggcttcatcactgcagacatgattaaaaac
cacctcccttccccgggcagcgagacactcattctcatgtgtgggccaccacctatgatt
cagtttgcatgtcagcccaacctggacacactcggctatcccaagagcagtactttttct
tactga

DBGET integrated database retrieval system