KEGG   Falco cherrug (Saker falcon): 102054017Help
Entry
102054017         CDS       T02911                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
fch  Falco cherrug (Saker falcon)
Brite
Enzymes [BR:fch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102054017
Peptidases [BR:fch01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   102054017
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102054017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 231 aa AA seqDB search
FFPPAHKTLKFATFAVLAPYDKKHFCGSSITVCNAALLEHGMMEWGWLACCPRLRTLLLH
LLLIYISVPFLIRLFPVLLTKFVYLNFLAFPFFVDFRRPELLLNNTINLYLTTEPDVTVG
IWHTVPSSRGDEAQGKDQRWYEEALADAHPIIIYLHGNGGTRAASHRVQFLKTMGAAGFH
ILALDYRGYGDSSGYPTESGFTTDVLALYDWAKARSGNSSILFWGHSLGTG
NT seq 698 nt NT seq  +upstreamnt  +downstreamnt
gatttttccctccagcccacaagaccctgaagtttgctacatttgctgtgctggctcctt
acgacaagaagcatttctgtggctcctccatcacagtgtgcaacgctgctttgctggagc
atggaatgatggaatggggctggctggcctgctgtccccggctgcgcaccctcctcctgc
acctgcttcttatctacatctccgtgcccttcctcatccgcctcttccctgtcttgctca
ccaaatttgtctacctgaacttcttggccttccccttcttcgtggactttcggcggccag
agctgctgctgaacaacaccatcaacctgtacctcaccactgagccagacgtcacggttg
gcatctggcacacggtgccgagcagcagaggggacgaggcgcagggcaaggaccagcgct
ggtatgaggaggcacttgccgacgctcaccctatcatcatctacctgcacggcaatgggg
gaaccagggctgcgagccaccgtgtccagttcttgaagacgatgggggctgctggattcc
acatcctggctctcgactacagaggctatggggactccagcgggtaccccacagagagcg
gctttaccacagatgtcctggcactctatgactgggccaaagcgcggagcgggaacagca
gcatccttttctggggacactccttggggacagggtag

DBGET integrated database retrieval system