KEGG   Falco cherrug (Saker falcon): 102054330Help
Entry
102054330         CDS       T02911                                 

Gene name
KAT6A
Definition
K(lysine) acetyltransferase 6A
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
fch  Falco cherrug (Saker falcon)
Brite
Enzymes [BR:fch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102054330 (KAT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1982 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDGKPNVDWNKLIKRAIEGLAESSGSSLKN
IERFLKGQKDVSASFGGSTASIFHQQLRLAVKRAVGHGRLLKDGPLYQLNTKATTNADGK
ESFESLSCLPPVCLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHP
SCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTR
MPKGMWICQICRPRKKGRKLLHKKAAQIKRRYANPIGRPKNRLKNQNTTSKGPFSKVRTG
PGRGRKRKIALSSQSATSEGGYLEQTDVLDFCRDGSTTLKFNKKTKGLIDGLTKFFTPSP
DGRKARGEVVDYSQQYRIRKKGTRKSSTSEWPTDNQDGWDGKQENEERFFGSQDVLTEKD
MELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIQTWYSSPYPQEYSRLPKLYLCE
FCLKYMKSRTILQQHMKKCGWVHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFL
DHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRF
LIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQRDKQLSIKKLSKLTG
ICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQEHMAKLRTNVRPIDVDAECLRWTPIIV
SNSVVSEDEEEETEDGENEEQQEQKEKDPDASMVKSVSWEKKEQEPYSPTESEKKPDIVA
PANSAWPNKHIFPLDSLPANSQPSRRGRWNRKSKKLREPFCEKEPVLPIEDKTAVPSGRC
SECEEKSTASRGRYAEDEEKSAVSQGQYGKGEKSAIPHRRYSEGMERWRGQLKKNTESLK
CRFPEDCNRLPRRYSDSDRALLRCFSESSEEEDDEPVSPRSSSPPVLTKPTLKRKKPILH
RKRRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEIEEEEEEDDDEE
EENELLPSGYFRHLAPPDTLRHRPSSKRKSKDEEESDDTNGNPTLKPLSMLRKCEAKDSS
LELDTSTPMKKKKGWPKGKSRKPVHWKKRPGRKPGFKLNQEKVPPSVQDEGVDAVGASSK
PGRKPKISDKEESAEQKEELPLIEERKEDDVNMEAEEVGEGEEEDTASSEVRAVSPVDSN
SSPVPEVKEPEIEEEVEEKPRVLEEQRQSEEEQQELDEPEHDHEEEEEVAVVTNQNEDHD
ADDEDDGHLESVKKKESEEQPVREGVKEEPQVQECFLEASIPSSREDAKEKDEAEADSEE
EQASNETSVGSEHIPGSEDDHEEEQSNKEGLIELKEEEEIPHSELDLETVQAVQSLTQEE
SNEHDVAYQDCEETLAACQTLQSYTQTEEDPQISMVEDCQASEHNSPISSVQSHPSQSVR
SVSSPNVPALESSYTQISPEQGSLSAPSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLGS
IESTTENYENPSSYDSTMGGSICGNNSSQSSCSYGGLSSSSSLTQNSCVVTQQMANIGSS
CSMMQQNTVQPAANCNIKSPQSCVVERPPSNQQPTTQPQQQQPQSQQPQPPPPPQQQPPL
SQCSMSNSFTPAPMIMEIPESGSTGNISIYERIPGDFGAGSYSQPSATFSLAKLQQLTNT
IMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHPLAGTPQAQATMTPPPNLASTTMN
LTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRSKSAPLPSATAHQQQLYGRSPPAV
AMQAGPRTLAVQRGMNMGVNLMPTTPYNVNSMNMNTLNAMNSYRMTQPMMNSSYHSNPAY
MNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNMMYTGPSHHSYMNAAGVPKQSLNGPYM
RR
NT seq 5949 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactagccaacccgctgtatacagagtggattttggaggcaatcaaaaaggta
aagaagcaaaaacagcgtccttctgaggagaggatatgcaatgcagtgtcatcttcacac
ggtttggaccgtaaaactgttctggaacagttagagttgagtgttaaagatggaactatt
ttaaaagtctccaacaagggtctcaactcctataaggatcctgataatcctgggagaata
gcacttccgaagcctcggaaccatggcaagttggatggtaaaccaaacgtggactggaat
aaacttatcaaacgggcaattgagggcttggctgagtctagcggctcatccttgaagaac
attgagcgctttctgaaaggtcagaaagatgtgtctgcatcatttggaggtagcactgcc
tccatttttcaccagcaactacgattagctgtcaaacgtgctgttggccatggcaggctc
cttaaagatggacctctgtaccaactcaacactaaagcaaccactaatgctgatgggaag
gaaagttttgagtctctttcctgtctccctccagtgtgtctccttccccatgaaaaggat
aagccggttgctgaacctattccaatctgcagtttctgccttggtacaaaagagcaaaat
cgagagaagaaacctgaagagctcatttcttgtgctgactgtggcaacagtggtcatccg
tcctgtttgaagttctctccagagttgacagttcgagtgaaagccttgcgatggcagtgt
attgagtgcaaaacatgcagttcctgtcgagatcagggcaaaaatgctgataacatgctg
ttttgtgactcatgtgaccgtggctttcacatggagtgctgtgacccccctcttaccagg
atgccaaaaggtatgtggatatgtcaaatatgtcggccacggaagaaaggaagaaaactt
ttacacaagaaggcagcacagataaaacgacgctatgctaacccaataggacgtccaaaa
aacaggttaaagaatcaaaatacaacctcaaaaggccctttcagcaaagtccgaactggc
cctggtcggggtcggaagcgtaagattgctctgtccagccagtcagcaacatcagaagga
ggatacctggagcagacagacgtcttggacttctgcagagatggcagcaccaccttaaag
tttaacaagaaaaccaaagggcttatagatggccttactaaattcttcactccctcccct
gatggacgaaaagctcgaggggaagtagtagactattctcagcagtacaggatcaggaaa
aagggtaccaggaaatctagcacttcagaatggcccacagacaatcaggacggatgggat
ggaaaacaggaaaatgaggagcgtttttttggaagccaggatgtcttaactgaaaaagac
atggagttgtttagagatattcaggaacaagcactgcagaaagtaggggtgactgggcct
cctgatccacaagtccgatgcccttctgtcatcgaatttggcaagtatgaaatccagacc
tggtactcctccccatatccacaggaatactcaaggctacccaagttgtacctttgtgaa
ttctgtctaaagtatatgaaaagcagaactattctccaacagcatatgaaaaagtgtggc
tgggttcatcctccagccaatgaaatttacagaaaaaacaatatttcagtctttgaggtt
gatggcaatgtcagcacaatatactgccagaatttgtgcttgttagccaaactcttcctg
gaccataagacactctattacgatgtggagccatttcttttctacgtgctgacacagaat
gatgtcaagggctgtcacctcgttggctacttttctaaggaaaaacactgccaacagaag
tacaatgtttcctgtataatgattcttccacagtaccagcgtaagggctatggcaggttc
ctaattgacttcagctatttgctttcaaagcgtgagggtcaagcaggatcaccagagaag
cccctgtcagacctggggcgcctctcatatatggcttattggaaaagtgtaatattggag
tgcctttatcatcagcgtgacaagcaattaagcatcaagaaattgagtaagctgactgga
atctgccctcaagatatcacttccactctacatcacctacgaatgcttgacttccgtagt
gatcagtttgtgatcattcgtcgggagaaacttatccaggagcatatggcaaagcttaga
actaatgtccgacctatagatgtggatgcagaatgcctacgttggacacctattatagtt
tccaactcggttgtctctgaagatgaagaagaggagacagaggatggggaaaatgaagag
caacaagagcagaaagaaaaggatccagatgccagcatggtaaaatctgtgtcgtgggag
aagaaagagcaagagccttactcacctacagagagtgaaaaaaagccagacattgttgct
ccagccaattctgcatggccaaacaagcacatttttcctctggatagtcttcctgcaaac
agtcagccatcacgaagaggtcggtggaaccgtaagagcaaaaaacttcgggagccattt
tgtgagaaggagccagtattgcccattgaggacaaaacagcagttcccagcgggcgatgc
agtgaatgtgaggagaaatccacagcctcacgaggccggtatgctgaagatgaggaaaaa
tctgcagtttcccagggacagtatggcaaaggtgaaaaatctgcaattccccatcggcgg
tacagtgaaggtatggaaaggtggagagggcagttgaaaaagaacacggagtccctgaag
tgtagattcccagaggactgcaacagattaccccgccgctacagtgacagtgatagggca
cttctgaggtgttttagtgagagtagtgaagaggaagatgatgagcctgtgagtcctcga
tccagctctccacctgttctcaccaagccaacattaaaacgaaagaaaccaatccttcat
cggaagaggcgagtccgcaaacgcaagcaccacaacagcagtgttgtcactgaaacaatc
tcagagaccacagaagtgctggatgaaccgtttgaggactcagactctgaacgaccaatg
ccccgattggagcctacattcgagattgaggaggaggaagaggaggatgacgacgaagag
gaggagaatgaacttttgcccagtggatactttcggcacttagccccaccagacacactc
aggcatagaccctcttctaagaggaagtccaaagatgaggaggagtctgatgacactaat
ggtaacccaactttgaaaccgttgtctatgctgagaaaatgtgaagcaaaggattcttca
cttgagctagatacttctacacccatgaaaaagaagaagggatggccaaaagggaaaagc
cgaaagccggtccactggaagaaaagacctggccgaaaaccaggttttaaactgaaccag
gaaaaggtaccaccatcagttcaggatgaaggagttgatgctgtgggagctagttcaaaa
ccagggcgtaagcccaaaatttcagataaagaagaaagtgctgagcagaaagaagagctg
cctcttattgaggaaaggaaagaagatgatgtgaatatggaagcagaagaggtaggagag
ggagaagaggaagatacagccagcagtgaagtaagggcagtttctcctgtggacagcaac
agcagtccagtgccagaagtaaaagagcctgagatagaagaggaagtagaggagaagcca
cgggttttagaagagcagaggcaatcagaagaagaacagcaagaactagatgaacctgag
catgaccatgaggaagaagaggaagtagctgtagtgacaaatcaaaatgaagatcatgat
gctgatgacgaagatgacggtcatctggagtcagtgaagaagaaagaatcggaggaacag
ccagttagagaaggggtaaaggaggagcctcaggtgcaagaatgttttttagaagcaagc
ataccaagcagtagagaagatgcaaaagaaaaagatgaagcagaggcagattctgaggaa
gagcaggcgtccaatgagacatcagttggctcagagcacatccctgggtctgaagatgat
cacgaagaagagcaaagtaataaagaagggttaattgaattaaaggaagaggaagaaatt
cctcatagtgaactagatcttgaaactgttcaagcagtccagtccttgacacaggaggaa
agcaatgagcatgatgtagcttaccaggactgtgaagaaactcttgcagcttgtcagact
ttgcagagttatacccagactgaggaggatcctcagatatcaatggttgaagattgccag
gcctcagaacacaacagtccaatatcctctgtgcagtcccaccccagccagtctgtacgt
tctgtcagcagcccaaatgtgcctgctttggagagcagttacacccagataagtcctgaa
caaggatccctgtccgcaccctctatgcagaacatggagaccagccccatgatggatgtg
ccttcagtatcagaccactctcagcaggtggtggatagtggcttcagtgaccttggcagc
attgagagcactacagagaattatgaaaaccccagcagctatgattccactatgggaggc
agcatttgtggaaataactcttcccagagcagctgttcatatggaggactatcctcttct
agcagcctcactcagaacagttgtgttgtcactcagcaaatggcaaacattggcagcagt
tgcagcatgatgcagcaaaacactgtccagcctgcagcaaactgcaatatcaagtcacct
cagagctgtgtagtagaaaggcctccaagtaaccagcaaccaacaacgcagccacaacag
caacagcctcagtcacagcagccacagcccccacctccaccccagcagcaacctccactg
tctcagtgtagcatgagtaacagcttcaccccagcacctatgatcatggaaatacctgaa
tcaggaagcactggtaacataagtatctatgagaggattccaggggattttggtgctggg
agctattcacaaccatcagccacgttcagtttagccaagttgcagcagctgacaaacacc
attatggaccctcatgccatgccttatagccattctcctgctgtgacttcctatgcaacc
agcgtttctctgtccaacacaggattggctcagctagctccctctcatccgttagcaggc
acaccgcaagcacaagccactatgacacccccaccaaatctggcgtccaccaccatgaac
ctcacatcacctctgcttcagtgtaatatgtctgctaccaatattggtattccacatacg
cagaggctgcaggggcaaatgccagtcaaggggcacatttccattcgctctaaatcagca
ccattgccctctgcaactgcacaccagcagcagctctatggccgcagcccacctgcagtt
gccatgcaggctggtcctcgtacattggctgttcagcggggtatgaacatgggagtcaac
ctaatgccaaccaccccttacaatgtcaattccatgaatatgaacaccctgaatgccatg
aacagctacaggatgacacagcctatgatgaacagcagttaccatagtaaccctgcctac
atgaaccagacagcacagtatcctatgcagatgcagatgggaatgatggggagccaggcc
tatacccagcagcctatgcagccaaatcctcatggaaacatgatgtacactggcccctcc
catcacagctacatgaatgctgctggggtgcccaagcagtctctcaatggaccatacatg
agaagatga

DBGET integrated database retrieval system