KEGG   Falco cherrug (Saker falcon): 102054348Help
Entry
102054348         CDS       T02911                                 

Gene name
EEF2K
Definition
eukaryotic elongation factor-2 kinase
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
fch  Falco cherrug (Saker falcon)
Brite
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     102054348 (EEF2K)
Protein kinases [BR:fch01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   102054348 (EEF2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 725 aa AA seqDB search
MADEDLIFRMEGIDNARSTTANSGNYLDAHSDDEDNYFICPITDDPVSNKSTGIKVDNYY
SNLAKTEQYSSSSSPRNSFSFKETWKHAIQKAKHMPDPWAEFHLEDIETEHATRYRYNAV
TGDWVEDEVLIKMASQPFGRGAMRECFRTKKLSNFLHTQNWKGAYNYVAKQYIESVGRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIVQTCIIEMKNRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIIVDIQGVGDLYTDPQIHTENGTDFGDGNL
GVRGMALFFHSHFCNKICKSMGLAQFDLSSKEKDALDCNKKLIESAQTILRGTEEKCGSS
RVRTVSGSRPPLLFRLSENSGDESMSDIAFDSLPCSPSSATPHSQKMDMLNWPVFNEVDN
LVHKDYDQLDNQRDSENGGDSGYPSEKRSELEDLDHRERGHSNNNRRHESDEDSLGSCAR
VSVEKWNLYNSSRVHIHRPSCVAQEIQRLNALELEKKIGRSVLGKVHLAMVRYHEAGRFC
EKDKEWDQESALFHLERAADCGELEAIVGLGLMCSQLPHHILSEVTLEDTRENRNKGFDY
LMRAAEAGDRPSMILVARAYDTGINLGSDRVQDWKEALYWYNAALNMTDYDEGGEYDGTQ
DEPRYLLLAREAEMLMTGGFQLNKDPQRSGELYTEAAEAAMEAMKGRLANQYYQKAEEAW
AMMEE
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaagaccttatttttcgtatggaagggattgataatgctagatcgactaca
gcaaactctggaaattatcttgatgctcatagtgatgatgaagacaattattttatctgt
ccaataactgatgatccagtttctaacaagtctactggtatcaaagttgacaattattat
agcaacttagcgaaaactgagcagtacagttcaagctcttctcctagaaactcctttagc
tttaaggaaacctggaaacatgctattcagaaagccaagcacatgcctgatccgtgggca
gaatttcatcttgaggacattgagacggaacatgccactcgttacaggtacaatgcagtt
actggggactgggttgaagatgaagtccttatcaagatggcttcacaaccttttggccgt
ggagcaatgcgagagtgtttcagaacgaaaaagctgtccaacttcttacacacacagaac
tggaaaggtgcttataactatgttgccaagcaatacatagagagcgtgggtagggatgtg
tattttgaggatgtccgacttcagatggaagcaaaactctggggagaagagtacaaccgg
cacaagccaccaaaacaggtggatatagtacagacctgtattattgaaatgaagaacaga
cctggaaagcctctctttcatttggaacactacattgagggcaaatacatcaaatataac
tcaaattctggttttgtgcgagacgacaacattcgtcttactccgcaagcctttagtcac
ttcacctttgaacgctcaggacaccaactcattattgttgatatccagggagttggagat
ctttacacagaccctcagatccatacagagaacggtacagattttggagatggcaaccta
ggtgttcgaggtatggccttgttctttcattctcatttctgcaacaagatttgcaaaagc
atgggtcttgcacaatttgatctttcatccaaagagaaagatgccttggattgtaataaa
aaattgattgaatctgctcaaacgattctccgtggcacagaggaaaaatgtggcagcagc
cgggtgagaactgtctctggtagtcggcctcctctgctcttccgcctgtctgaaaactct
ggagatgaaagcatgagcgacatagcatttgactctctaccctgctctccttcctcagca
actcctcacagccagaagatggacatgcttaattggcctgtgttcaatgaagtagataac
ttggttcacaaagactatgatcagcttgataaccaaagggattctgaaaatggtggagac
agtgggtatcccagtgaaaaaagaagtgaactagaagatctggatcatagagagaggggc
cattcaaacaacaaccgaagacatgaatctgatgaagacagtttgggaagctgtgcaagg
gtcagtgtggagaaatggaatctctacaactcttccagagtccacatccacagaccatcc
tgtgttgcccaagaaattcagaggctcaatgcactagaacttgaaaagaaaattgggagg
tcagtccttgggaaggttcatttggccatggttcgctatcatgaagctgggcgtttctgt
gagaaggacaaggaatgggatcaggagtcagccctgtttcacctcgagcgtgctgcagac
tgtggggagctggaagccatcgtgggattaggactcatgtgctctcagctgccacatcac
attctttctgaggtcactctggaggacacgagggagaacagaaataaaggatttgattac
ttgatgagagcagcagaagctggagaccgaccttccatgattctggtggcaagagcatac
gatacaggcataaatcttggttcagacagagtacaggattggaaggaggcgctgtactgg
tacaacgctgcactgaacatgaccgactacgatgagggaggtgaatatgatggcactcag
gacgagccccggtatctgctcctggccagggaggcagagatgttaatgacgggagggttc
caattgaataaggatccacagagatcaggtgagctgtacacagaggcagcagaagcagcg
atggaagccatgaaaggcagactggcaaatcagtactaccaaaaagcagaagaggcttgg
gcgatgatggaagaataa

DBGET integrated database retrieval system