KEGG   Falco cherrug (Saker falcon): 102055046Help
Entry
102055046         CDS       T02911                                 

Gene name
GBE1
Definition
glucan (1,4-alpha-), branching enzyme 1
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102055046 (GBE1)
Enzymes [BR:fch01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     102055046 (GBE1)
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102055046 (GBE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 916 aa AA seqDB search
MIQTITFAKWYSLFYNRLKNIEESEGGLDKFSKSYKTFGVNQFVDGGIYCKEWAPGAEAV
FLAGDFNGWNPFSHPYKKMEYGKWELFIPPGQDGYPPVAHGSKLKVVIRAQNGELLYRIS
PWARYVVRDEDKVNYDWVHWNPPESYIHKHPSPKRLKSLRIYESHVGIASPEGKVASYKN
FTYNVLPRIKDLGYNCVQLMAIMEHAYYASFGYQVTSFFAASSRYGTPDDLKEMIDVAHS
MGITVLLDVVHSHASKNSEDGLNKFDGTDSCFFHSGPKGTHQLWDSRLFDYANWEVLRFL
LSNLRMWIEDYRFDGFRFDGVTSMLYHHHGIGTGFSGDYNEYFGLQVDEDALCYLMLANH
MIKFLHPECITIAEDVSGMPALCRPVAEGGGGFDYRLAMAIPDKWIQIIKELKDEDWNMG
NIVHTLTNRRYEEKYIAYAESHDQALVGDKTLAFRLMDAEMYTNMSVLSPLTAVIDRGIQ
LHKMIRLITHALGGESYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFNLTEDHLLRYR
FLNAFDRDMNKLEERFGWLASPPAFVSEKHESNKVIAFERAGLIFIFNFHPYQSYVDYRV
GIETPGKYPFNCCLFYKILLDSDAAEYGGHQRLDHSTEYFSEEYPHNYRPNSLMACAVIQ
SFAATLTIGNRHKTSYPQDTQPPELEVWDEEQNVLTVQEEMVSDLLLHLDTHKSTGPDGI
HTRKALGDGVSKHCMWLLRFREQLEVDEFGMAVLKSAINTRDLKRDVDTSLLLVLVAFLG
LLNVVQILFRIKQLSPATLTPTTGTEATPTPVAGTAATSIPTTSTMATQTSVACTAATKK
LATNTTATQTLVMSDAAEPEDQPMLVSVAPIHKKKGTQKAACLVKEDEAGSSQEQQEELA
QEVTTRSLSLSELQDT
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgatccaaacaattacttttgcgaagtggtattctctgttttataaccgcttgaagaac
attgaagaaagtgaaggcggccttgacaaattttcaaaaagttacaaaacctttggagtt
aatcagtttgtggatggcggaatatattgcaaagagtgggcaccaggagcagaagcagtg
tttctcgcaggtgacttcaatggctggaatccattttctcatccatataagaagatggaa
tatgggaagtgggagttgttcatcccacctggacaagatggttatcctcctgtggcccac
ggatcaaagctaaaggtggtgatccgtgctcaaaatggcgaactcctctatcgtatttca
ccttgggcaagatatgtagtccgtgatgaagacaaagtgaattacgattgggtacactgg
aatccaccagagtcatatatacataagcatccttcccccaagagattaaaaagcctaaga
atctatgaatctcatgtggggattgcttccccagaagggaaagtagcttcttacaaaaac
ttcacatacaatgtactacctagaataaaggatcttggatataactgtgtccagctgatg
gctattatggaacatgcatactatgccagttttggttatcaggtcacaagcttctttgca
gcatcaagccgttatggaactccagacgacctgaaagaaatgattgacgttgctcactca
atgggcatcactgtcctgctggacgttgtgcacagccatgcatcaaaaaactctgaagac
ggtctcaacaaatttgatggtacagattcttgtttcttccattctggtcctaaaggaact
catcagctctgggacagcaggctctttgactatgcaaactgggaagttttgagattcctt
ctgtctaatttgagaatgtggattgaagactatcgctttgatggattccggtttgatggt
gttacatctatgttgtatcaccatcatgggattggcacaggattcagtggagattacaat
gaatattttggcctacaagtggatgaagatgctttgtgttatctcatgctggccaaccac
atgattaaattcttgcatccagaatgcataaccatagcggaggatgtttctggaatgcca
gctctttgtcgtcccgttgcagagggaggagggggtttcgattatcgactagccatggct
attccagataaatggatacagattattaaggagctgaaagatgaagactggaatatgggc
aatattgtgcatacattaacaaacagacggtatgaagaaaaatacattgcatatgcagag
agtcatgaccaggcgcttgttggtgataagaccttggcgtttcgactgatggatgcagaa
atgtatacaaacatgagtgtgctctcacctcttactgcagttattgatcgtggaatacag
cttcataaaatgattcgtctcattactcatgcacttggaggagagagctatctgaacttc
atgggcaacgaatttggacatccagaatggcttgacttccccagaaaaggaaataatgag
agctaccactatgccagaagacagtttaatcttactgaggatcatcttctccgctataga
ttcctaaacgcatttgatagagatatgaataaattggaggaaagatttggctggcttgca
tctcccccggcctttgtgagtgaaaagcatgaatccaataaggtcatagcatttgagaga
gcaggtctcatttttattttcaacttccatccatatcaaagttatgtggactacagagtg
ggtattgaaactccaggaaaatatccttttaattgctgtttgttttataaaatccttctg
gattctgatgctgcagaatatggaggacatcaaaggctggaccacagtacagaatacttc
tctgaagaatatcctcacaattatcgacctaattcacttatggcgtgtgcagttatccag
tcctttgctgctacgcttacaataggtaacaggcacaagaccagttaccctcaggatact
cagcctcctgagctggaagtctgggatgaggagcaaaatgtcctcacagtccaggaggaa
atggtcagtgacctgcttctgcacttggacacgcacaagtctacggggccagatgggatc
cacacgaggaaggctcttggtgatggagtatccaagcattgcatgtggctcttgcgcttc
cgtgagcagttagaggttgacgagttcggcatggcagttttgaaaagtgccataaacacc
agggacctaaaaagagatgttgacaccagcctcttgctggtcctggttgcgttcttagga
ctgctgaatgtggttcagatcttgtttagaattaagcaactgtctccagctactctgacc
cccacaacaggcactgaggctaccccaaccccagtggcaggcactgcagctacttcaatc
cccacaacaagcactatggctactcaaacctcagtggcatgcactgcagctactaaaaaa
ctggcaactaacactacagcaactcagaccctggtgatgagtgatgcagctgaaccagag
gaccaacccatgctggtatcagttgcccctatacacaagaagaaagggacacaaaaggca
gcttgtttagtaaaggaagacgaagcagggtcatcacaggaacagcaggaagagttagca
caagaggtaaccactcgatccctatccctgagtgagctgcaggatacgtga

DBGET integrated database retrieval system