KEGG   Falco cherrug (Saker falcon): 102056467Help
Entry
102056467         CDS       T02911                                 

Gene name
MAOA
Definition
monoamine oxidase A
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:fch00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:fch00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:fch00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:fch00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:fch00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:fch00380]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:fch00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 446 aa AA seqDB search
MKICCVVFQLLMFLYVFXGKSRSFTGISPSTWNPFVYLDYNNFWRTMDKLGKEIPLEAPW
DAPHAEEWDKMTMKELIDKICWTKAAREFATLFVNINVTSEPHEVSALWFLWYVRQCGGT
ARIFSITNGGQERKFKGGSGQISEKIMERLEGRVKLERPVVLIDQTGDNVIVETLNHEIY
EGKYVISAIPPILTTKIHYKPALPPKRNQLIQRLPMGCVIKCMVYYREAFWQRKGYCGSF
LIEDEESPIGITIDDTKPDGSFPAIMGFILTRKAIKLAHLNKEERKKKICEAYAKAMGME
EALHPVHYEEKNWSMEQYSGGCYTAYFPPGIMYSYGRIIRQPIDRIYFAGTETATQWSGY
MEGAVQAGERAAREILYRMGRISENEIWMPEPESKDVPARPFTTSFWERNLPSAPGLLCL
LSSAIFFTSVAAAGLFACKKGQLIRN
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaagatatgctgtgttgtgtttcagttgcttatgttcttatatgtattttagggaaag
tcacgctctttcacaggtatttccccttcaacatggaatcccttcgtttatctggattac
aataacttctggaggactatggacaagctaggaaaagagattcctcttgaagcaccatgg
gacgctccgcatgctgaggaatgggacaaaatgaccatgaaagagctgatagataagata
tgctggaccaaagctgctagagaatttgccaccttatttgtgaatatcaacgtcacatcc
gagcctcatgaagtctctgctctctggttcctgtggtatgtgaggcagtgtgggggcaca
gccaggattttctccatcaccaatgggggccaggagaggaagtttaaagggggttctggt
cagatatcggagaaaataatggaacgccttgaaggcagagttaaactggagagacctgtg
gtccttattgatcagacaggtgataatgtcattgtggagactctaaaccatgagatatat
gagggcaagtatgtgatcagtgctatccctccgatcctgacaacgaagattcattacaaa
ccagcactacctccaaagagaaaccagttaattcagcgtttgcctatggggtgtgtcata
aaatgcatggtgtactacagggaagccttctggcagaggaagggttattgtggttccttc
ctcattgaggatgaagagtctccaattggaataaccatagatgacacgaaacctgatgga
tctttccctgccattatgggtttcatccttaccagaaaggccattaaactggcccatctc
aataaggaagagaggaagaagaagatctgtgaggcatatgccaaagcaatggggatggaa
gaggctttacatccagtgcattatgaagaaaagaactggagcatggagcaatattcagga
ggttgctacacagcctacttcccaccaggcataatgtattcttacggaaggatcattcgg
cagcccattgacagaatctactttgctggcacagagacagctacccaatggagtggatac
atggagggggccgtacaggcaggagagagagcagccagagagatactgtacaggatgggg
aggatctcagagaatgaaatttggatgccagagccggagtcaaaggatgtcccagcccga
ccattcaccaccagcttctgggagaggaacctgccctccgcaccaggattgctgtgcctg
cttagctctgccatcttcttcacctctgtggctgctgcagggctgtttgcctgtaaaaag
ggacagctaattcgaaactag

DBGET integrated database retrieval system