KEGG   Falco cherrug (Saker falcon): 102056647Help
Entry
102056647         CDS       T02911                                 

Definition
pancreatic alpha-amylase-like
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102056647
Enzymes [BR:fch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     102056647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 333 aa AA seqDB search
MSIFFLLLVVGVCWAQYSPNALSGRTSIVHLFEWRWADIALECERYLAPNGFGGVQISPP
NENVIITDPWQPWWERYQPVSYKLCTRSGNETEFRDMVTRCNNVGVHIYVDAVINHMCGA
HAGAGSHATCGSYFSAKTEDFPAVPYSGWDFNDGKCKSRSGDIENYHDISQVRDCRLVSL
LDLALEKDYVRSKVAEYMNHLIDIGVAGFRIDAAKHMWPGDLKAVLDKLNDLNMKWFSAG
TKPFIYQEILIECQGSSGLLFYRWHDGSLFLEYFCLSYKSVPNEDLKLCHDQKSESVFEG
GISVGQSRKKTKRENDVELTSQIVTDSIDLCEF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcttttttctgctgttagttgtaggagtttgctgggcacagtacagccctaac
gcgctctctgggaggacgtctattgtacatctcttcgaatggcgctgggcggatattgct
ctggagtgtgagcgctatttagctcctaatggatttggaggagttcagatttcacctcca
aatgaaaatgttatcattactgacccctggcaaccatggtgggaaagataccagcctgtc
agctacaagctgtgcacacgatctggaaatgaaactgaatttagagacatggtgaccagg
tgcaacaatgttggagtacatatttatgtggatgcagtaatcaaccacatgtgtggagct
catgctggtgctggcagccatgctacttgtgggagctatttcagtgcaaagactgaagat
tttccagctgtgccttattctggctgggacttcaatgatggtaaatgtaaatctagaagt
ggagacattgagaattatcatgatatatctcaggtccgagactgccgcttggtgagcctt
cttgatctggccctggagaaggactatgtccgctcaaaagttgctgagtacatgaaccac
ctcattgatattggtgtagcaggcttccgaattgatgctgccaagcatatgtggccgggg
gacctgaaggcagttttagacaagctgaatgacctaaacatgaaatggttttctgcagga
actaaacctttcatttaccaggagatactcattgaatgtcagggatcttctggtcttttg
ttttatcgttggcatgatgggagcttattcttggagtatttttgcttatcttataaatca
gttccaaatgaagacctgaaattatgtcatgatcaaaagtcagaaagtgtttttgaagga
ggaatttctgttgggcaatccaggaaaaaaacaaaacgggagaatgatgttgagctaact
agccaaatagtaactgatagcattgatctgtgtgaattttga

DBGET integrated database retrieval system