KEGG   Falco cherrug (Saker falcon): 102056653Help
Entry
102056653         CDS       T02911                                 

Gene name
CREBBP
Definition
(RefSeq) CREB binding protein
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Melanogenesis
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:fch00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    102056653 (CREBBP)
   04330 Notch signaling pathway
    102056653 (CREBBP)
   04350 TGF-beta signaling pathway
    102056653 (CREBBP)
   04068 FoxO signaling pathway
    102056653 (CREBBP)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102056653 (CREBBP)
  Cellular community - eukaryotes
   04520 Adherens junction
    102056653 (CREBBP)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    102056653 (CREBBP)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    102056653 (CREBBP)
   05168 Herpes simplex infection
    102056653 (CREBBP)
Enzymes [BR:fch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102056653 (CREBBP)
Transcription factors [BR:fch03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    102056653 (CREBBP)
Chromosome [BR:fch03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102056653 (CREBBP)
Mitochondrial biogenesis [BR:fch03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102056653 (CREBBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 2341 aa AA seqDB search
MGKSPLNSGDSSASGLAKQAASTSGPTTPASQTLNSQAQKQVGLVTSSPATSQTGPGICM
NTNFSQTHQSLLNSNSGHSLMNQPQQGQGQVMNGSLGAAGXAGMQYSAPAMQGNAGSVLA
ETLTQVSPQMTGHTGLNTAQTGAMTKMGMTGNTSPFGQPFSQTGGQQMGATGVNPQLPNK
PGMANSLSPFPADIKSTPVTSVPNMSQMQTQVQQVGIVPTQAMATGPTADPEKRKLIQQQ
LVLLLHAHKCQRREQANGEVRACALPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIIS
HWKNCTRHDCPVCLPLKNASDKRNQQPLLGSPAGGIQNSIGSVGTGQQNTPSLSNPNPID
PSSMQRAYAALGLPYGNQPQTQLQPQVQGQQPAQPQAHQQMRTINALGANQMNLPAGGIT
TDQQASLISETALPTSLGTNNPLMNDGTNSGNVGNLSSMPTAAPPSSTGVRKAWHEHVTQ
DLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANSRDEYYHLLAEKI
YKIQKELEEKRRSRLHKQGMLGNQPALQTPGPQPPGIPQVAAAMGQAQPVRPPNGPMSMP
TVPISRMQVSQGMNQFNPMSIGNVQMPQAPMGPRAASPMNHPVQMNNMGAVPAMAMSPSR
MPQPQNMMGAHSNNMMGQAPTQNQFLPQNQFPASSGAMNVNSVGMGQSTAQAGVAQQGQV
PSAALPNSMNMLGPQSGQLPCPPVTQPPLHQTTPPVSTAAGMPPIQHQTPTGMTPPQPAA
PTQPSTPVSSSGQTPTPTPGSVPNATQTQSTPTGQTAAQAQVTPQPQTPVQPQSVPTPQP
SQQQPTSVQAQPPGTPLSQAAASIDNRVPTPASVASADTNSQQLGPDAPMLESKSEVKTE
ETEPETSETQVEAKTEVEEDLQGSSQTKEETDGAELKQEPMEIEEKKPEIKVDAKEEEES
STNGTTSQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDY
FDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCTKLAEVF
EQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQ
GENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSG
FVCDNCLKKTGRTRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASS
DKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPN
TRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFH
CHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFW
PNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANK
KKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRD
AFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCED
YDLCINCYNTKSHDHKMVKWGLGLDDESNSQGEQQSKSPQESRRLSIQRCIQSLVHACQC
RNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLN
IKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSATPGTPTQQPSTPQTPQP
PPQPQPSPVSMSPAGFPSVSRTQPPTTVSTGKPANPVSAPPPPAQPPPAAVEAARQIERE
AAQQQQQLYRVNNINNGLPPGRPGLVNPTVGSVNQMQQVSMNVPRPNPVSGPVMSNMQPG
QWQSPPMPQQQPMQPGMARPVMPMATPQAVAGPRMPGVQQPPRSIPPNALQDLLRTLKSP
SSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVANQPGMQPQAGIQPQPGMQQPQTGMQQP
GMHAQAGLQNMNAMQAGVQRPSVPPQQQGIGAMNPQGQAINIMNPGHNPSMANMSPQYRE
ILRRQLLQQQQQQQQQQGGAGMAGGMAGHNQFQQPQGPGGYPQAMQQQRMQQHISIQGGS
MGQMAQMGQLNQMGQPGMGADGTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHML
SGQPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTG
SPHPGLAVTMASSMDQGHLGNPEQSAMLPQLNTPNRSALSNELSLVGDTTGDTLEKFVEG
L
NT seq 7026 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagagccctttaaactcgggagactcttctgcttcaggcctggcaaagcaagca
gccagcacctctggacctaccacacctgcatcacaaactctgaactctcaagcacaaaaa
caagtggggttggtgacaagcagccctgcaacatcacagactggacctgggatatgtatg
aatactaatttcagtcagacacaccagagccttctcaacagtaattctggtcacagttta
atgaatcagcctcagcaaggacaagggcaggtaatgaatggatctcttggggcagctgga
nnagcaggaatgcaatattctgcccctgccatgcaggggaatgcaggcagtgtgctggca
gagactttaacccaagtatctccacagatgactggtcacaccggactgaacacagcacag
acaggagcaatgacaaaaatgggaatgacaggtaacactagtccctttgggcagcctttc
agtcaaactggagggcagcagatgggagctacaggagtgaatcctcagttaccaaacaag
ccaggcatggcgaatagtttgtctccctttcctgccgacattaagagtactccagtcacc
agtgtgccaaatatgtcccagatgcaaacccaagtgcaacaagtggggatcgtaccgacg
caggcaatggcaactggaccaacagcagacccggagaagcgcaaactgatccagcagcag
ttggttttgctgcttcatgctcacaaatgtcagaggcgtgagcaagcgaacggagaggtg
cgggcctgtgctctcccgcattgtcgaaccatgaaaaatgtcctcaaccacatgacacac
tgtcaagctgggaaggcctgtcaagttgctcattgtgcatcttcaagacaaatcatctcc
cactggaagaattgtactcggcacgactgtcctgtgtgccttcctttgaaaaacgccagt
gacaaaagaaatcaacaaccccttttagggtctccagctggtggaatccaaaattccatc
ggttctgttggcacaggccagcagaacactccatcgctaagtaatcctaatccaattgac
cccagctccatgcaacgagcctacgctgctcttggactgccatatggcaaccagcctcaa
acacagttgcagccccaggtacaaggccaacagccggcacagcctcaggctcaccagcaa
atgaggaccattaatgcattgggagccaaccagatgaaccttcccgcaggaggaataaca
acagaccagcaagctagtctaatttctgaaactgctcttccaacatcccttgggacaaat
aacccactaatgaatgatggcacaaattctggcaatgttggaaacctcagctcaatgcca
acggctgcacctccttctagtaccggggtaaggaaagcatggcatgaacatgtcactcag
gacctgcgcaatcatttagtgcataaacttgtccaagccatcttccccactcctgatccg
gcagcactgaaggatcgccgcatggagaacttggtggcttatgccaggaaagtggaagga
gatatgtatgaatctgctaatagcagggatgaatattatcatttattagcagagaaaatc
tataagatacaaaaggagctggaagagaaacggaggtctcgtctacataaacaagggatg
ttggggaatcagccagccttacagacccctggacctcagccccctggtatcccacaggtg
gctgctgccatgggccaggcacagcccgtgaggccgcccaatgggcctatgtccatgcca
accgtgcctataagtcgtatgcaggtttctcaaggaatgaatcagtttaaccccatgtcc
atagggaatgtacagatgccacaagcacccatgggaccccgtgcagcttctccaatgaac
catcctgtacagatgaacaacatgggcgctgttcctgcgatggcaatgtctccttcccga
atgcctcagccacagaacatgatgggagctcattccaacaacatgatgggtcaggctcct
acccagaaccaattcctgccccagaatcagtttccagcatccagtggggctatgaatgtg
aacagcgtgggcatgggtcagtcaacagcccaggctggggtggcacagcaggggcaggtt
cccagtgctgctcttcccaactccatgaacatgctaggaccgcagagtgggcagttacca
tgtccaccagtgacccagccacctctacatcagactacacctcctgtgtctactgctgct
gggatgccacctattcagcaccaaacgccaactggaatgactccccctcagccagcagca
cccactcagccatcgacaccagtctcatcttcaggacaaacaccaacaccaacaccgggt
tctgttccaaacgcgacacagacacaaagcacgcctacagggcagactgcggcacaggct
caagtcacaccgcaacctcagaccccagttcaaccccagtctgtgccaaccccgcagcca
tctcagcagcagccaacatctgtgcaggcacagccacctggcactccactatcccaggca
gcagctagtattgataacagggtccccacccctgcctcagttgctagtgctgatacgaat
tcccagcaactaggaccagatgcaccaatgctagaaagcaaatcagaagttaaaactgaa
gaaactgagccagagactagtgagacacaagtggaagctaagactgaggtggaggaggat
ttacaaggatcttcacaaacaaaagaagaaacggatggagcagaactgaaacaggagcca
atggaaatagaagaaaagaagcctgaaataaaagtagatgctaaagaggaagaggagagc
agcactaacggaaccacttcacaatccacatcgccatctcagccccgcaaaaaaattttc
aaacctgaggagctgcgccaggctctcatgcctacccttgaagctttgtaccggcaggac
ccagagtctctaccttttaggcagcctgtggatccccagcttttagggattccagactac
ttcgacattgtgaagaatcctatggatctttcaaccattaaacgtaaattggatactggg
cagtaccaagaaccctggcagtatgtggacgatgtctggctaatgtttaacaacgcctgg
ctttacaatcgcaagacttccagggtctataagttttgcactaaactcgcggaggtgttt
gaacaagaaatcgatcccgttatgcaatcacttggctactgttgtgggcgcaagtatgag
ttttctccacagaccttgtgctgctatggcaagcagctgtgtactattcctcgtgatgct
gcctactacagttaccagaacaggtatcacttctgtgagaagtgtttcactgaaatccag
ggggagaatgtcaccctgggtgatgacccttcccagcctcaaacaaccatctctaaggat
cagtttgaaaagaagaaaaatgatacactagatccagagccgtttgttgactgcaaagag
tgtggtcggaagatgcaccagatttgtgtattacattatgatattatttggccttccggg
tttgtctgtgataattgtctgaagaaaactggtagaacacgcaaagaaaacaaattcagt
gctaaaaggctacagactacacgtttaggaaaccatttggaagacagagtaaacaaattt
ttacgacgacagaatcatcctgaagctggagaggtctttgtcagagtagtagccagttca
gataagacagtagaagttaaaccaggaatgaaatccagatttgtggattctggtgagatg
tcagaatctttcccttaccgtaccaaagctctatttgcatttgaggagatagacggagta
gatgtgtgcttcttcggcatgcacgtacaggagtacggctcggattgcccccctccaaat
acaaggcgtgtgtacatatcgtatctagatagtattcatttcttccgcccccgttgtctc
cgaactgcagtttatcatgaaatcctcattggatatttggagtatgtgaagaaacttggg
tatgtgacaggacacatctgggcctgtcccccaagtgaaggagatgactatatttttcat
tgccatccgcctgatcagaaaatacccaaacccaaacgtttgcaagaatggtataagaag
atgctggacaaggcatttgctgagagaatcattcacgactacaaggacatcttcaaacaa
gcaactgaggacaggctgacgagtgccaaggagctgccttactttgaaggtgatttctgg
cccaatgtgctggaagaaagcattaaggagttggagcaggaggaggaggaaaggaaaaag
gaagaaagtactgcagctagtgaaacaacagagggaagccagggcgacagcaagaacgcc
aagaaaaagaacaacaaaaaaaccaacaagaataagagtagcatcagcagagctaacaag
aagaaacccagcatgccaaatgtgtccaatgatttgtctcagaagctgtatgccactatg
gagaagcataaagaggtcttttttgtgattcatttacatgctgggcctgtaattaacacc
ctgcctcccattgtggaccctgatccattacttagttgtgatttgatggatgggcgagat
gccttcctcaccttagccagagataagcactgggagttctcctcgctacgccggtccaag
tggtccacgctctgcatgctggtagaactgcacactcaagggcaggatcgctttgtctac
acgtgcaatgagtgcaaacatcatgtggaaacaaggtggcattgcactgtctgtgaggac
tacgacctctgcattaactgctacaacactaagagccatgaccacaagatggttaagtgg
ggcctgggtctggatgatgagagcaacagccaaggggagcaacagtcaaagagcccccag
gagtcgcgacgactgagcatccagcgctgcattcagtcccttgtccatgcctgtcagtgc
cgcaatgcaaactgctcattgccatcctgccagaagatgaaacgggttgtccagcacacc
aagggctgcaagcgcaagaccaacggcggctgtccggtgtgcaaacagctcatagctctt
tgctgctaccatgccaaacactgccaagagaacaaatgccctgtgccattctgtctcaat
atcaaacacaagcttcgacagcagcagatccagcatcgcctgcagcaggctcagctcatg
cgcagaaggatggctaccatgaacacccgaaacgtgcctcagcaaagtttgccttctcct
acctcagcaacgcctggtacccctacgcagcagccaagtacaccgcaaacaccgcagcct
cctccccagccccagccttcccctgtaagtatgtcaccggctggctttcccagcgtgtcg
agaactcagccccctactactgtttcaacaggaaaacctgcgaacccggtttccgcgcct
ccacctccggctcagcctccgccggccgcggtggaagcggctcggcagatcgagcgagaa
gctgcgcagcagcagcagcagctctacagggtcaacaacattaacaatggtttgcctcct
ggtcgcccaggactagtaaacccgacggtgggttcagtgaaccagatgcagcaagtcagc
atgaatgtaccccggcccaaccccgtcagcggtccagtgatgtccaacatgcagcctggg
cagtggcagtcgcctccgatgccacagcagcaaccgatgcagccgggaatggcgagaccg
gtgatgccgatggcgacaccacaagcggtggccgggccgaggatgccaggcgtgcagcag
ccgccgcggagcatccccccaaatgcacttcaggacttactgaggaccttgaaatcacca
agttctccgcagcagcagcagcaggttcttaatatccttaaatccaaccctcagcttatg
gcagcttttataaagcaaagaacagccaaatacgtggctaaccagcctgggatgcagccg
caagcgggcatacagccccagcctgggatgcagcagccgcagaccggcatgcaacagcca
ggcatgcacgctcaagcaggattgcagaacatgaacgcgatgcaagcaggagtgcagcga
ccgagcgttcctccccagcagcaagggataggagctatgaatccccagggacaagcgata
aacattatgaaccccggccacaaccccagcatggcaaacatgagtccgcagtaccgagaa
atcctgaggcggcaattactgcagcagcagcagcaacagcagcagcagcaaggaggggct
ggcatggcaggagggatggcaggacataaccagttccagcagcctcaaggaccaggaggt
taccctcaagccatgcagcagcagcggatgcagcagcatatatcgatacagggggggtcc
atgggacagatggctcagatgggacagctgaaccagatgggccagcccggcatgggggca
gacggcactcccaacatccagcaagcactgcagcagcgcatcctgcagcagcagcagatg
aagcagcagatagggtcccccggccagcccaaccccatgagcccacagcagcacatgctc
tcaggacaaccgcaggcgtctcatctccctggccagcagatcgccacctccctcagcaac
caggtgcggtccccagcacccgttcagtctccccgtccccagtcccagccaccacattcc
agcccgtcacccaggatacagccccaaccgtcacctcaccacgtctctccccagactggt
tccccccacccaggactcgcagttactatggctagctccatggatcagggacacttgggc
aacccagaacagagtgcaatgcttccacaactaaacaccccgaacaggagtgcgttgtct
aacgaattgtctctggtcggtgacaccaccggggacacattagaaaaatttgtggagggt
ttgtag

DBGET integrated database retrieval system