KEGG   Falco cherrug (Saker falcon): 102057066Help
Entry
102057066         CDS       T02911                                 

Gene name
POR
Definition
P450 (cytochrome) oxidoreductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
fch  Falco cherrug (Saker falcon)
Brite
Enzymes [BR:fch01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     102057066 (POR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 675 aa AA seqDB search
MGGAGMEQNISPANSPAQQDSLFSMMDVFLISLITGLFTYWFFFRKKKEEVPDLPKMQSV
AAPVRDSSFIEKMKKTGRNIVVFYGSQTGTAEEFANRLAKDAHRYGLRGMAADPEEYDLS
DLSRLSEIDKSLAVFCMATYGEGDPTDNAQDFYDWLQEADADLSGLRFAVFGLGNKTYEH
FNAMGKYVDKRLEELGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGEES
SIRQYELVVHTDVNMNKVYTGEMGRLKSYENQKPPFDAKNPFLAQVTENRKLNEGGERHL
MHLELDISNSKIRYESGDHVAVYPANDSSLVNQIGEILGTDLDTIMSLNNLDEESNKKHP
FPCPTSYRTALMYYLDITNPPRTNVLYELAQYATDAGEQERLRKMASSAAEGKALYLSWV
VEARRNILAILQDMPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNAIHICAVTVEYET
KTGRLNKGVATNWLKNKVPNENGSNSLVPMYVRKSQFRLPFKPSTPVIMIGPGTGIAPFI
GFIQERAWLKQQGKEVGETGLYYGLRAGGYLYREELARFHQEGVLTQLNVAFSRDQAEKV
YVQHLLKKNKENIWKLINEGNAHIYVCGDARNMARDVQNTFYEIVAEFGNMGQPQAVDYV
KKLMTKGRYSLDVWS
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggggggtgctggcatggaacaaaacatctcccctgccaacagccctgcgcagcaagac
tcgctcttcagcatgatggacgtgtttctcatctcgctcatcaccgggctttttacgtac
tggttcttcttccgcaagaaaaaagaggaagtcccagacctccccaaaatgcaatcagta
gcagctccagtgagagacagcagcttcattgagaagatgaagaagacggggcgaaacata
gtggttttctacggttcccagacaggtacagcagaggagtttgccaatcgtctcgccaaa
gatgctcatcgctatggcctcaggggcatggcagcggatccagaggagtatgacttgtcg
gacctgagtcgcctctctgagatcgacaagtccttagctgtgttctgcatggccacttac
ggcgagggtgaccccacagacaacgcccaagacttctatgactggctgcaggaggctgat
gctgacctgtcaggtctccgatttgcagtcttcgggctggggaacaagacttatgagcac
ttcaatgccatggggaagtatgtggacaagaggctggaggaacttggagcccagcgcatc
tttgaactcgggctgggagatgacgatggcaacctggaagaagacttcatcacctggagg
gagcagttctggccagcagtgtgtgagcacttcggggtggaggctacaggagaagagtcc
agcatccgccagtatgagctggtggtgcacaccgatgttaacatgaacaaagtctacacc
ggtgagatgggccgcctcaagagctatgagaaccagaagccaccatttgatgccaagaac
cccttcctggcccaggttacagagaaccgcaagctgaatgagggtggagagcgacacctt
atgcacctggagctggatatctctaattccaaaatcaggtatgagtctggggaccatgtg
gcggtgtatccagccaacgactcttctctggtgaatcagatcggtgagatcctgggcacg
gatctggacacgatcatgtccctgaacaatttggatgaggaatccaataagaaacatccc
ttcccctgccccacgtcctaccgtacagccctgatgtactacctggacatcaccaacccg
ccccgcaccaacgtcctctacgagctggcacagtacgccacggacgccggcgagcaggag
cgcctccgcaaaatggcatcgtctgctgccgaggggaaggctctctacctcagctgggtg
gtggaggcccggaggaacatccttgccatcctgcaggacatgccctcgctgcgccccccc
attgatcacttgtgcgagctcctgccccgcctgcaggcccgctactactccattgcctcc
tcgtccaaggttcaccccaacgccatccacatctgtgccgtgacggtggagtatgagacc
aagacgggacgcttgaacaaaggggtggccaccaactggctcaagaacaaggtgcccaac
gagaatgggagcaactccctggtgcccatgtacgtcaggaagtcacagttccgcctgccc
ttcaaacccagcacgcccgtcatcatgatcggaccgggaactggcatagcccccttcatc
ggcttcattcaggagcgggcctggctgaagcagcaaggcaaagaggtgggcgagacgggg
ctttactacggcttgcgcgcgggggggtacctgtaccgcgaggagctggcccgcttccat
caggagggagtcctcacccaactcaacgtggccttttccagggaccaggctgagaaggtt
tatgttcagcacttactgaagaagaacaaggaaaacatctggaagctgattaatgagggg
aatgctcatatctacgtgtgcggcgatgctcgcaacatggcccgggatgtgcagaacacc
ttctatgagatcgtggccgagttcgggaacatgggccagccccaggccgtggactatgta
aagaaactgatgacgaagggccggtactctctggatgtctggagctaa

DBGET integrated database retrieval system