KEGG   Falco cherrug (Saker falcon): 102057232Help
Entry
102057232         CDS       T02911                                 

Gene name
ALPI
Definition
(RefSeq) intestinal-type alkaline phosphatase
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102057232 (ALPI)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     102057232 (ALPI)
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102057232 (ALPI)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fch00537]
 Enzymes
  102057232 (ALPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 533 aa AA seqDB search
MKLLAPLALCLGLWAGISTTAAIPAGTDGCCPVPEEEEKPSFWNKQAAAAIEASFKIQPR
ISQAKNLILFLGDGFGIPTITATRILKGQEQGNLGPETPLALDAFPYVALSKTYNVDRQV
PDSAGTATAYLCGVKGNYKTVGLSAAARHLQCNTTAGNEVISVLERARKAGKAVGIVTTT
RVQHASPSGTYAHVVDRNWYADASMPMEARKQGCEDIAWQLVHNVDINVILGGGRKYMTP
VGTPDPEYPIYRSQNGIREDGNNLINMWLEARPGARYVWNRTGLLAAAADPSVNYLMGLF
EPADMKYSLVRDTTLDPSLTEMMEAAITILSRNPNGFYLFVEDKSGGRIDHGHHDGTAHK
ALTEAVEFDRAIERANALTDEAQTLTVVTADHSHVFSFGGYTLRGSSIFGLAPSKASDEK
NYTSILYGNGPGYPGTSRTDVDEDTAARYDYLQQAAVLLSSETHGGEDVAILAKGPMAHL
FHGVQEQTYVAHVMAYAACLEPYTACRQRGSAPSTRATPLAMLLPTLLLPLFH
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcctggcacccctcgccctgtgcctgggcctctgggcagggatcagcactact
gccgccatcccagctgggactgatgggtgctgccctgtcccagaggaggaggagaagcca
tccttttggaacaagcaggcagctgcagccatcgaagcctccttcaagatccagcccagg
ataagccaagccaaaaacctcatcctcttccttggggatggattcgggatccccaccatc
acggccacccgcatcctaaaggggcaggagcaggggaacctgggccccgagacccccctc
gccctggatgctttcccctacgtggctctctccaagacgtacaatgtggaccggcaggtc
cctgacagcgcggggacagccacagcctacctctgcggggtgaagggcaactacaagacg
gtgggactgagcgcagccgcccgccacttgcagtgcaacaccactgcaggcaacgaggtg
atctcagtgctggagcgagctcgcaaagccgggaaggcagtgggcattgtgacaacaaca
cgggtgcagcatgcgtcgccctcggggacctatgcccacgtggtggaccgcaactggtac
gcggatgccagcatgcccatggaagcccgcaaacagggctgcgaggacatcgcctggcag
ttggtccacaacgttgacatcaatgtgatcctggggggcggtcggaaatacatgacccct
gtggggacaccggaccctgagtatcccatctacaggagccagaatgggatacgtgaggat
gggaataacctcatcaacatgtggctggaggcacggccgggtgcccgctacgtctggaac
aggacagggctgctggctgctgctgctgaccccagtgtgaactatttgatgggtctcttt
gaacccgcagacatgaagtacagcctggtgcgtgacaccaccctggacccatcgctcact
gagatgatggaagcagccatcaccatcctgagcaggaaccccaatggcttctacctcttc
gtggaagataagtcaggcggcaggattgaccacggccaccacgatggtacagcccataag
gcactgacagaggcggtggagtttgaccgggccattgagcgggcaaacgccctgacagac
gaggcgcagacactcaccgtcgtcaccgctgaccactcacatgtcttctcctttggtggc
tacaccctgcgtggctcctccatcttcggtctggccccaagcaaagccagtgacgagaag
aactacacatccatcctctacgggaatgggccaggctacccaggcaccagccggactgat
gtggatgaggacacagctgcgcggtacgactacttgcagcaggcagccgtgctcctcagc
tcagagacccatggtggtgaagacgtggccatcctggccaaaggccccatggcccacctc
ttccacggggtgcaggagcagacctacgtggcccacgtcatggcctacgccgcctgcctc
gagccctacactgcctgccgccagcggggctctgcccccagcacccgtgccacccccctg
gccatgctcctgcccaccctcctcctgcccctcttccactga

DBGET integrated database retrieval system