KEGG   Falco cherrug (Saker falcon): 102057415Help
Entry
102057415         CDS       T02911                                 

Gene name
KAT2B
Definition
(RefSeq) lysine acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102057415 (KAT2B)
Enzymes [BR:fch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102057415 (KAT2B)
Transcription machinery [BR:fch03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102057415 (KAT2B)
Chromosome [BR:fch03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102057415 (KAT2B)
   HAT complexes
    PCAF complex
     102057415 (KAT2B)
    STAGA complex
     102057415 (KAT2B)
    TFTC complex
     102057415 (KAT2B)
    SAGA complex
     102057415 (KAT2B)
    SLIK complex
     102057415 (KAT2B)
    ADA-HAT complex
     102057415 (KAT2B)
    HAT-A2 complex
     102057415 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 732 aa AA seqDB search
MKAEESCKCNGWKNPNPPPTPPRAELQQAAVSLAEPCRSCSHTLAAHVSHLENVSEEEMN
RLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKCILQMGKPVVEGSLESPPFEKPS
IEQGVNNFVQYKFSHLPSKERQTIVELAKMFLNRINYWHLETPSQRRLRSPNDDIAGYKV
NYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPQEKRT
LILTHFPKFLSMLEEEVYSQNSPIWDQDFMLSSSRTGQLGIQTVISPPPVARSVSYSASP
SSLEQPNSGSMSPACKISSALDPNLGEKRKNNEPYSLEDSKRPRIVGDIPIELINEVMST
ITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKIMMWLVGLQN
VFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNE
QVKGYGTHLMNHLKEYHIKHNILNFLTYADEYAIGYFKKQGFSKDIKVPKAKYVGYIKDY
EGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPI
ESIPGIRETGWKPSGKERGKEPKDPDQLYSTLKTILQQVKSHQSAWPFMEPVKRTEAPGY
YEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCREYNPPESEYYKCANILEKFF
YTKIKEAGLIDK
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgaggagtcctgtaaatgcaatggctggaagaaccccaacccgcctcccacg
ccgccgcgggcagagctgcagcaggcagcggtgagccttgccgagccttgccgcagctgc
agccacacactggctgctcatgtttctcacctggagaacgtgtctgaagaagaaatgaat
aggctccttgggattgtattggatgtggagtatctgttcacctgtgtccacaaagaggaa
gatgcagacaccaagcaagtttatttctacctgttcaaacttttgaggaagtgcatttta
cagatgggaaaacctgtagtagaaggatctttggaaagtcccccatttgagaaacctagc
attgaacagggtgtgaataatttcgtgcagtacaaatttagccacttaccctcaaaggaa
aggcaaacgatagtggaactggcaaaaatgtttctgaaccgcattaactactggcacctg
gagacaccttctcagcgaagactaagatcacctaatgatgatattgcggggtataaagtg
aattataccagatggctttgttattgcaatgtccctcagttctgtgacagtctacctcgg
tatgaaaccacacaggttttcggtaggacattgcttcgctctgtttttactgtaatgaga
cggcaactgctggagcaggccaggcaagaaaaagacaagcttcctcaggagaaacgaaca
ctaatcctcacccattttcccaagtttctgtcgatgctggaagaagaagtgtacagccag
aattctcccatttgggatcaggatttcatgttgtctagttcccgaactggccagctggga
atccagacagttatcagtcctcctcctgtggcaagatctgtttcatacagtgcaagtcct
tcgtctctggagcaacccaacagtgggagtatgagtcctgcttgcaaaatttcttctgcc
cttgacccaaacctaggggaaaagagaaaaaataatgaaccctattctctggaggattcc
aaaagaccaaggattgtaggagatattcctattgagttaatcaatgaagtaatgtcaaca
attacagatcctgcagcaatgcttgggccagagaccaacttcctctcggcgcactcggcc
cgggacgaggcggcgaggctggaggagcgcaggggggtgatcgagttccacgtagttggc
aactcgctgaaccagaagcccaacaagaagatcatgatgtggctggttggtttgcagaat
gtgttctcccatcagctgcctcgaatgccgaaggagtacatcacacgcttggtctttgat
ccgaaacacaagacccttgcattaataaaagatggtcgtgttattggtggtatctgcttc
cgcatgttcccctcccaaggatttacggagattgttttctgtgctgtgacttccaatgag
caagtcaagggttatgggactcacctaatgaaccatctgaaggagtaccacatcaaacac
aacattctcaactttctcacgtacgcagatgaatacgctatcggctacttcaaaaaacaa
ggtttctccaaagatattaaagtaccaaaagcaaaatatgttggctacatcaaggattat
gagggtgccacattaatgggatgtgaattaaatccaaggatcccctacacggaattttct
gtcatcattaaaaagcaaaaagagatcattaaaaagctcatagaaaggaaacaagctcag
atacggaaagtttatcctggcctttcttgcttcaaagacggagtacggcagattcctata
gaaagcattcctggaattagagagactggctggaaaccgagtggaaaagaaagaggtaag
gagcccaaggatccagatcaactttacagcacattaaaaaccatcctgcagcaagtgaag
agccatcaaagcgcttggcccttcatggaacctgtgaagagaacagaagctcctggatat
tatgaagttataaggtttcccatggatctcaaaacaatgagtgagcgactcaagaatagg
tactacgtgtctaagaaattattcatggcagacttgcagcgagtctttacaaattgcaga
gagtacaacccccccgagagtgaatactacaaatgtgccaatatactggagaaattcttc
tacacaaaaattaaagaagctggattaattgacaagtga

DBGET integrated database retrieval system