KEGG   Falco cherrug (Saker falcon): 102057415Help
Entry
102057415         CDS       T02911                                 

Gene name
KAT2B
Definition
K(lysine) acetyltransferase 2B
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102057415 (KAT2B)
Enzymes [BR:fch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102057415 (KAT2B)
Transcription machinery [BR:fch03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102057415 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 732 aa AA seqDB search
MKAEESCKCNGWKNPNPPPTPPRAELQQAAVSLAEPCRSCSHTLAAHVSHLENVSEEEMN
RLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKCILQMGKPVVEGSLESPPFEKPS
IEQGVNNFVQYKFSHLPSKERQTIVELAKMFLNRINYWHLETPSQRRLRSPNDDIAGYKV
NYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPQEKRT
LILTHFPKFLSMLEEEVYSQNSPIWDQDFMLSSSRTGQLGIQTVISPPPVARSVSYSASP
SSLEQPNSGSMSPACKISSALDPNLGEKRKNNEPYSLEDSKRPRIVGDIPIELINEVMST
ITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKIMMWLVGLQN
VFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNE
QVKGYGTHLMNHLKEYHIKHNILNFLTYADEYAIGYFKKQGFSKDIKVPKAKYVGYIKDY
EGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPI
ESIPGIRETGWKPSGKERGKEPKDPDQLYSTLKTILQQVKSHQSAWPFMEPVKRTEAPGY
YEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCREYNPPESEYYKCANILEKFF
YTKIKEAGLIDK
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgaggagtcctgtaaatgcaatggctggaagaaccccaacccgcctcccacg
ccgccgcgggcagagctgcagcaggcagcggtgagccttgccgagccttgccgcagctgc
agccacacactggctgctcatgtttctcacctggagaacgtgtctgaagaagaaatgaat
aggctccttgggattgtattggatgtggagtatctgttcacctgtgtccacaaagaggaa
gatgcagacaccaagcaagtttatttctacctgttcaaacttttgaggaagtgcatttta
cagatgggaaaacctgtagtagaaggatctttggaaagtcccccatttgagaaacctagc
attgaacagggtgtgaataatttcgtgcagtacaaatttagccacttaccctcaaaggaa
aggcaaacgatagtggaactggcaaaaatgtttctgaaccgcattaactactggcacctg
gagacaccttctcagcgaagactaagatcacctaatgatgatattgcggggtataaagtg
aattataccagatggctttgttattgcaatgtccctcagttctgtgacagtctacctcgg
tatgaaaccacacaggttttcggtaggacattgcttcgctctgtttttactgtaatgaga
cggcaactgctggagcaggccaggcaagaaaaagacaagcttcctcaggagaaacgaaca
ctaatcctcacccattttcccaagtttctgtcgatgctggaagaagaagtgtacagccag
aattctcccatttgggatcaggatttcatgttgtctagttcccgaactggccagctggga
atccagacagttatcagtcctcctcctgtggcaagatctgtttcatacagtgcaagtcct
tcgtctctggagcaacccaacagtgggagtatgagtcctgcttgcaaaatttcttctgcc
cttgacccaaacctaggggaaaagagaaaaaataatgaaccctattctctggaggattcc
aaaagaccaaggattgtaggagatattcctattgagttaatcaatgaagtaatgtcaaca
attacagatcctgcagcaatgcttgggccagagaccaacttcctctcggcgcactcggcc
cgggacgaggcggcgaggctggaggagcgcaggggggtgatcgagttccacgtagttggc
aactcgctgaaccagaagcccaacaagaagatcatgatgtggctggttggtttgcagaat
gtgttctcccatcagctgcctcgaatgccgaaggagtacatcacacgcttggtctttgat
ccgaaacacaagacccttgcattaataaaagatggtcgtgttattggtggtatctgcttc
cgcatgttcccctcccaaggatttacggagattgttttctgtgctgtgacttccaatgag
caagtcaagggttatgggactcacctaatgaaccatctgaaggagtaccacatcaaacac
aacattctcaactttctcacgtacgcagatgaatacgctatcggctacttcaaaaaacaa
ggtttctccaaagatattaaagtaccaaaagcaaaatatgttggctacatcaaggattat
gagggtgccacattaatgggatgtgaattaaatccaaggatcccctacacggaattttct
gtcatcattaaaaagcaaaaagagatcattaaaaagctcatagaaaggaaacaagctcag
atacggaaagtttatcctggcctttcttgcttcaaagacggagtacggcagattcctata
gaaagcattcctggaattagagagactggctggaaaccgagtggaaaagaaagaggtaag
gagcccaaggatccagatcaactttacagcacattaaaaaccatcctgcagcaagtgaag
agccatcaaagcgcttggcccttcatggaacctgtgaagagaacagaagctcctggatat
tatgaagttataaggtttcccatggatctcaaaacaatgagtgagcgactcaagaatagg
tactacgtgtctaagaaattattcatggcagacttgcagcgagtctttacaaattgcaga
gagtacaacccccccgagagtgaatactacaaatgtgccaatatactggagaaattcttc
tacacaaaaattaaagaagctggattaattgacaagtga

DBGET integrated database retrieval system