KEGG   Falco cherrug (Saker falcon): 102057591Help
Entry
102057591         CDS       T02911                                 

Gene name
NCOA1
Definition
nuclear receptor coactivator 1
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
fch  Falco cherrug (Saker falcon)
Brite
Enzymes [BR:fch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102057591 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1449 aa AA seqDB search
MSGLGDSSTDPANPDSRKRKGSPCDTAQSNEKRRREQENKYLEELAELLSANIGDIDTLS
VKPDKCKILKKTVDQIQQMKRLEQEKAADDEVQKSDISSSSQGVIEKESLGPLLLEALDG
FFFVVNREGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNGVP
WPQEATRRNSHTFSCRMLIRPPDEPGAENQEARQRYEVMQCFTVSQPKSFKEEGEDFQSC
LICIARRLPRPAAVTPSESFVTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQP
QGREPSYAKQLFQEVMTRGTAFSPSYRFTLSDGTVLSAHTKCKLCYPSSPEMQPFIMGIH
VIDRDHGMLSPQENTNSAMSLPRVSPSLNPSISPGQGMALPPSIPPSNGSMLATNVNQQP
GAGLHNSNSSTSQTSFGCSPGNQIGANVALSQGQAGPQNSNHTLNLSSSPMNSPGITPPQ
FMSPRHRVSPGLVPRPRVPSNPFSPTMPTMHSPVGMANSGSGGGCGTGGTRPFPSAPINS
MQGLTEGPSTPVGYSTPPPVLRQLSSQSSPGRLAMQPMKAESKDNKEIASILSEMIQSDG
GSGDGKPLDSGMLHASDRLSEGDSKCSQATSHKLVQLLATTAEQQLRHADADTSCKDSLA
CAGTAGTLASGNPPSSTCPSSHSSLTERHKILHRLLQEGSPSDITTLAMEHEKKETAPNP
ATTPTAQSQLPGTPDIKLEPDALKKKDVKDHQLLRYLLDKDEKELAAAPALSLDDVKVKV
EKTEQMEPCNTAPVPLAKPPAAEEVKLETQGQFAAELEQLDQLLPSLEKAAQLPGLCGPE
RSESGVASVAVKPEMLAAPLQPSATARAPTGLNRTSKLELEAICKRFGQPGMGEQIPWTD
NSMAAMNRGALNKPEDQCITSQLDELLCPPTTPEGRNDEKALLEQLVSFLSGKDETELAE
LDRALGIDKLVQGGGLKARTGRFQPQQATPPLMMEQKPGMYPQPYSSASPTTNLPGAFPG
MVRQKPSFGPMPVQVPPPRSAFPTTMAMQPRQTLNRPPTAPNQLRLQLQQRLQGQQQLIH
QNRQAILNQFAANSPVGINMRAGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLMQQR
AILMRQQSFGNNLPPSAGLPVQIGAARLPQAPPQQFPYPPNYGTTPGNPPTSTSPFSPLA
SNPEAALANRSSMVNRGMMGGVGGQFGTGMTPQMQQNIFQYSGSGMGQQSEPAFAPSLSP
SSPLMSPQLPPSQSPMLQPAPPTPGYQSPDMKTWQQGAMGNSNVFSQAGQSQPAPAQQGM
YNNMSITVSMAGGNTNVQNMNPMAGQMQMNSLQMPGMNSMCSEQVNDPALRPTGLYCNQL
SSTDLLKTEADGAQQVQQVQVFADVQCTVNLVGDPYLNPPAPLGTPKNAAGPPPPPGQQK
SLLQQLLTE
NT seq 4350 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggggacagctcaacggaccctgccaaccccgactctcggaagaggaaa
ggctcgccctgcgatacagcccagagcaatgaaaagcgacgacgggaacaggagaacaaa
tacttagaggagctggcggagctgttatctgcaaacatcggggacatcgacaccctgagt
gtcaaacccgacaaatgcaagatcctaaaaaagacggttgatcagatccagcagatgaag
aggttggagcaagagaaagcagctgatgatgaagtgcagaagtctgacatctcatccagc
agccaaggagtgattgagaaggagtctctgggacctcttcttctggaggcgttggatggc
ttcttcttcgttgtgaaccgcgaagggaggatcgtcttcgtctctgagaacgtgaccagc
tacctgggttataaccaggaggagctcatgaacaccagtgtctacagcatcctgcacgtg
ggggatcacgccgagttcgtcaagaacttgttgccaaagtctctagtaaacggagttcct
tggcctcaagaagcaaccaggcgcaacagccataccttcagctgcaggatgctgatccgg
ccgcctgacgaaccaggtgctgagaaccaggaggctcgtcagcgctacgaggtgatgcag
tgcttcactgtctcccagcccaagtccttcaaggaggaaggagaagatttccagtcatgt
ctaatatgcattgcaaggcgattacctcgaccagcagccgtcaccccttccgaatccttc
gtgaccaagcaagacaccacaggtaaaatcatctccattgacaccagttccctgagagct
gctggcaggacgggctgggaggatttggtgcggaaatgcatctacgctttcttccagccg
cagggcagagagccatcttatgccaagcagctctttcaagaagtgatgacacgtggcacg
gccttcagcccctcgtaccgattcaccctgagcgacgggacggtgcttagtgcccacacc
aagtgtaagctctgctacccctccagcccagagatgcagcccttcatcatgggcatccac
gtcatcgacagggatcatggcatgctctcaccccaggagaacactaactccgcaatgtcc
cttccccgggtcagcccctcactgaaccccagcatctccccagggcaaggcatggccctg
ccgccctccatccctccctccaacggcagcatgttggccaccaacgtgaaccagcagcca
ggcgccggcctccacaacagcaactccagcaccagccaaaccagctttggatgttcacct
ggaaaccagataggagccaatgttgccttaagccagggacaagctggtccccagaacagt
aaccacactttgaacctcagtagctcccccatgaatagtccggggatcaccccaccacag
ttcatgtctccaaggcatcgggtcagcccagggctggtgcccagacccagggtgcccagc
aatcccttctcacccaccatgcccaccatgcactcccccgtgggcatggccaacagtggc
agtgggggcggctgtggcaccggtggcaccagaccctttcccagcgcccccataaactct
atgcaggggctgaccgaagggcccagcacaccggtgggctactccacgccaccccccgtg
ctgagacagctcagctcccagagctcgcccggccgcctcgccatgcagcccatgaaagca
gagtcgaaggacaacaaagagatcgcctccatcctgagcgagatgatccagtcggatggc
ggttcgggggatggaaaaccgctggactcgggcatgctgcacgccagcgacaggctctca
gagggggacagcaagtgctcccaagccaccagccacaagctggtccagctcctggccacc
acagcggagcagcagcttcggcacgctgatgcggacacgagctgcaaagattcattagcc
tgcgcgggcaccgccggcaccttggcctccggcaaccctcccagcagcacctgcccttcc
tcccatagctcactgaccgagcggcacaagatcttgcatagactccttcaggagggcagc
ccttccgatatcaccaccctggccatggagcacgagaagaaggagacggcgccgaaccct
gccaccacccccacggctcagagccagctgccgggcaccccggacatcaaactggagccg
gacgcgctgaagaaaaaagatgtcaaggatcaccagctcctgcgctatctgctggacaaa
gacgagaaggagcttgctgcagccccggcgctgagcctggatgatgtgaaggtgaaggtg
gagaagacggagcaaatggagccttgtaacacagccccggtgccgctcgccaaacctcct
gcagcggaggaggtcaagctggagacgcagggccagtttgctgctgaactggagcagctg
gaccagctcctgccctcgctggagaaggcggctcagctgcccggcttgtgtggaccagag
agaagtgagagcggtgtggccagcgttgctgtcaaaccagagatgctggcagctcccctg
cagcccagcgccactgccagagcccccacgggactcaaccgtacgtccaagttagagtta
gaagctatttgcaagcgatttggacagccaggaatgggggagcagatcccctggacggat
aacagcatggcagccatgaatcgcggcgcgctgaataaacccgaagaccagtgcatcacc
tcccagctggatgagctcctgtgtcctcccaccacgccggagggtcggaacgacgagaaa
gccctgctcgagcagctcgtctccttcctcagcggcaaagacgagacggagctggccgag
ctggatcgagctctggggattgacaaactggtccagggcggcggtttgaaagcccggaca
gggcggttccagccccaacaagccaccccaccgctcatgatggagcagaaacccggcatg
tacccccagccttactcctccgcctctcccaccaccaacctccccggcgccttccccggc
atggtcaggcagaagccgtccttcggacccatgccggtgcaggtcccgccgccccgcagc
gccttccccaccaccatggccatgcaaccccggcagacgctcaacagacccccgacggcc
cccaaccagctgcgacttcagctgcagcagcggctgcagggccagcagcagctgatccat
caaaaccggcaggcgatcctcaaccagtttgcagccaattccccggtgggcatcaacatg
cgggcggggatgcagcagcagatcacgccgcagcctcccctcaatgcccagatgctggcc
cagcgccagcgcgagctctacagccagcagcaccggcagcggcagctcatgcagcagcga
gccatcctgatgaggcagcaaagctttggaaacaacctccctccctctgccgggctccca
gtgcagatcggagccgctcgcttgccccaggcacccccacagcagttcccttacccccca
aactacggtacgaccccaggaaaccctcccacctccaccagccccttctcaccgttggca
tccaaccctgaggccgcgctggctaaccgcagcagcatggtgaacagggggatgatgggc
ggcgtcggagggcagttcggcactgggatgaccccgcagatgcaacagaacatctttcag
tattcgggatcaggcatgggtcagcaaagcgaacccgcctttgctccgtcgctcagtccc
agcagccccttgatgtcaccccagctcccgccttcgcaaagccccatgctgcagccagct
ccgccgacaccgggctaccagtcgcctgacatgaagacctggcagcagggagccatgggg
aacagcaatgtattcagccaagcggggcagagccagccggcgcctgctcagcagggcatg
tacaacaacatgagcatcaccgtctccatggcgggaggaaacaccaacgtccagaacatg
aaccccatggccggacagatgcagatgaactcactgcagatgcccgggatgaactccatg
tgctcggagcaggtaaatgacccggcgctgagacccacgggcctttactgcaaccagctt
tcctccactgaccttttgaaaacagaagcagatggggcgcagcaggtacaacaggttcag
gtctttgccgacgtacagtgtacagtgaatctggtaggagatccctacctcaacccgccg
gctcccttgggcaccccgaaaaacgccgccgggccaccaccaccgccgggccagcagaag
agccttcttcagcagctactgactgaataa

DBGET integrated database retrieval system