KEGG   Falco cherrug (Saker falcon): 102058192Help
Entry
102058192         CDS       T02911                                 

Gene name
UCHL5
Definition
ubiquitin carboxyl-terminal hydrolase L5
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
fch  Falco cherrug (Saker falcon)
Brite
Enzymes [BR:fch01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102058192 (UCHL5)
Peptidases [BR:fch01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102058192 (UCHL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 314 aa AA seqDB search
MKKPLFFLVTGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLD
TIFFAKQVINNACATQAIVSVLLNCAHQDIHLGETLSEFKEFSQSFDAAMKGLALSNSEV
IRQVHNSFARQQMFEFDAKSSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDD
WISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQRIAELQQQLAEEEPMDTDQSSN
MLSSIQSEVAKYQMLIEEENQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEK
AKEKQNAKKVQEAK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacctctatttttccttgttacaggttgtagaggagcacaagttgaagaaata
tggagtttggaaccagagaactttgaaaaattgaagccagtgcatggattaattttcctc
ttcaagtggcagcctggagaggaaccagcaggttctgttgttcaggattctagactggat
acaatattttttgctaaacaggtaatcaataatgcttgtgctactcaagccatagtaagt
gtgctattaaattgtgctcatcaagatatccatctaggagagactttgtcagaatttaaa
gaattttcacaaagttttgatgctgcgatgaaaggtttggcactaagcaattcggaagtg
attcggcaagttcacaacagttttgccagacaacagatgtttgaatttgatgcaaagtct
tcggcaaaagaagaagatgcatttcactttgtaagctatgttcctgttaatggacggcta
tatgaactagatggcttaagggaaggaccaattgacttgggtgcatgcaatcaagatgac
tggataagtgctgtacggcctgtcatagagaaacgtatacaaaagtacagcgaaggtgag
ataaggtttaacttgatggctattgtatctgacagaaagatgatatatgagcagaggatt
gcagaattacagcagcagcttgcagaggaggagcctatggatacagatcaaagtagtaat
atgttaagttctatacaatcagaagttgcaaaataccagatgttaattgaagaagagaac
caaaaattaaaaagatataagatcgaaaatattagaagaaaacataactacctgcctttc
atcatggaattattaaagactttagcagagcaccaacagttaataccattagtagaaaaa
gcgaaagaaaaacagaatgccaagaaagttcaggaggccaagtga

DBGET integrated database retrieval system