KEGG   Falco cherrug (Saker falcon): 102058351Help
Entry
102058351         CDS       T02911                                 

Gene name
MAOB
Definition
monoamine oxidase B
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102058351 (MAOB)
   00330 Arginine and proline metabolism
    102058351 (MAOB)
   00340 Histidine metabolism
    102058351 (MAOB)
   00350 Tyrosine metabolism
    102058351 (MAOB)
   00360 Phenylalanine metabolism
    102058351 (MAOB)
   00380 Tryptophan metabolism
    102058351 (MAOB)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102058351 (MAOB)
Enzymes [BR:fch01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     102058351 (MAOB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 543 aa AA seqDB search
MDLVQWEFASRNSEEILALFISLLLKHPRDAGANIVAGLSAAKLLTESGLNVVLLEANDR
VGGRTFTVRNNQVKYVDLGGAYVGPTQNRLLRLSKELGIETYKVNEDEHLIHHVKGKSYP
FKGPFPPMWNPLAYLDYNNLWRTMDEMGKEIPSEAPWKAPHAEEWDKMTMQDFIDKTCWT
NAAKSFATLFVNVDVTSEPHEVSALWFLWYVKQCGGTARIFSTTNGGQERKFVGGSGQIS
EKIMERLGSRVKLRKPVVHIDQLGESVIVETLDHELYEGKYVISAIPPALGLKIHFNPPL
PPMRNQLINRIPMGSVIKCIVYYKETFWRKKGYCGTMIIEDEDAAIGLTLDDTKPDGSFP
AIIGFILARKCRRLTGLTKEERKTRLCELYAKVLGSEEALHPVHYEEKNWCEEQYSGGCY
TAYFPPGIMTQYGRIIRQPIGRIYFAGTETATEWSGYMEGAVQAGERAAREILFAMRKIP
DSEIWKPEPESVDVPALPITTTFWERNLPSVPGLLKLIGFSTFFTSVAVAGLFAYKKGLL
VRN
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggacctggtgcagtgggagtttgcatccaggaattcagaagaaatcttggctctgttc
atatcgctgttgctgaagcaccctcgtgatgcaggtgctaatatagttgcaggtctctct
gcagccaaactgctgactgagtcaggcttgaatgtggtgttgctggaagccaatgacagg
gttggtggaagaactttcactgtaaggaataatcaagttaagtatgtggatcttggagga
gcgtatgtggggccaacacaaaatcgtctcctgcggttatctaaagagttaggaatagag
acgtataaagtgaatgaagacgagcacctgatacatcatgtcaagggtaagtcttacccc
tttaaaggtccatttcctcctatgtggaatccgttggcctacctggactacaacaactta
tggaggaccatggatgaaatgggaaaggagattcccagtgaagctccatggaaggctcca
catgcagaagaatgggacaaaatgactatgcaagatttcatagataaaacttgctggaca
aatgctgccaagagttttgcaactctgtttgtgaatgtggatgtcacttctgaaccccac
gaggtctctgccctttggtttttgtggtatgtgaagcagtgtggtgggacagcaaggata
ttctcaacgaccaatggaggacaggagaggaagtttgttgggggctctggccagataagt
gagaaaataatggagcgcctgggaagccgagtgaagctgaggaagccagttgtccacatc
gaccagttgggtgaaagtgtcatagtggaaacattagatcatgaattatatgagggcaaa
tatgtgatcagtgccattcccccagctcttggtttgaagattcatttcaacccacctttg
cccccaatgagaaaccagctcatcaaccgaattcccatgggttcggtcatcaagtgcatt
gtgtactataaggaaactttctggaggaagaaggggtattgtggtaccatgatcattgaa
gatgaggatgctgcaattggtttaacacttgatgatactaagcctgatggcagctttcct
gccataataggcttcattcttgctcggaaatgtagaaggctgacaggtctcacaaaagaa
gaaaggaagacgaggctgtgtgagctctacgcaaaggttctgggatcagaggaagcttta
catccagtgcattatgaagagaagaactggtgtgaagagcagtattctgggggctgctac
acagcctacttcccaccaggcataatgactcagtatggaaggatcattcggcagcccatt
ggcagaatctattttgctggcacagagacagccacagagtggagtggatacatggagggg
gccgtgcaggctggagaaagagcagccagagagatactgtttgctatgaggaaaatccca
gacagtgaaatttggaagccagaacctgaatctgttgatgttccagctttgcccatcact
acaaccttctgggagaggaacttgccatctgtgccaggactgctaaagctgattggattt
tccacattcttcacctctgtggctgtggctgggttatttgcttacaaaaagggacttcta
gttcgaaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system