KEGG   Falco cherrug (Saker falcon): 102058640Help
Entry
102058640         CDS       T02911                                 

Definition
erythroblast NAD(P)(+)--arginine ADP-ribosyltransferase-like
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
fch  Falco cherrug (Saker falcon)
Brite
Enzymes [BR:fch01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102058640
Cellular antigens [BR:fch04090]
 Proteins
  102058640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 294 aa AA seqDB search
MEHLVLGLVLLAGKLAAGSPLHQQDLDPVKEVALDMAPTSFDDRYQGCSHMMEEELQELN
RTEFANNSIYAKAWTVATAEWRSRRGRAPQTRALTPAQAIALLAYTEQGPLHQAFNTAVR
KAGHSRREYLGAFQFKVLHFLLSEALCTLRDAQPHHCHHVYRGIRGIRFTAQRHQSIRFG
HFTSTSLRNESTLPFGRDTFFSVETCYGVPIRDFSFFPEEEEVLIPPFETFQVIDITHDG
DRALIQLRSQGALSTYNCELVKEKRCKSQPCIFSAGESSPIPRTQVTPGSLDVL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctggtgctgggcttggtgctgctggctgggaaactggctgctggcagcccc
ttgcaccagcaagacctcgaccctgtcaaggaggtggcgctggacatggcccccacctcc
tttgatgaccggtaccagggctgcagccacatgatggaggaggagctgcaggagctcaac
cgcactgagtttgccaacaacagcatctacgccaaggcctggactgttgccactgctgaa
tggcggagccggcggggacgtgctcctcagacacgagcactgacaccagcgcaggcgatt
gccctactggcatatacggaacagggccccctgcaccaggcgttcaacacagctgttcgc
aaggctgggcactcccgcagggaatacctgggtgccttccagttcaaggtgctgcatttc
ctcctgagcgaggccctgtgcactctgcgggatgcccagccccaccactgccaccacgtt
taccggggcatccgtggcatacgcttcactgcccagcgccaccaatccatccgcttcggc
cacttcacctccacctccctccggaatgagagcaccctgccctttggccgggacaccttc
ttttcagtggagacctgctacggtgtccccatcagagacttctccttcttccctgaggag
gaagaggtcctcatcccacccttcgagaccttccaggtcatcgacatcacccatgatggg
gacagagccctcatccagctccgctcccagggtgcgctgagcacctacaactgcgagttg
gtgaaagagaagagatgcaagagccagccgtgcatcttcagcgcaggtgagagcagcccc
atccccaggacacaggtgacaccgggcagccttgatgtgctttaa

DBGET integrated database retrieval system