KEGG   Falco cherrug (Saker falcon): 102058798Help
Entry
102058798         CDS       T02911                                 

Gene name
TGM6
Definition
transglutaminase 6
Orthology
K05624  
transglutaminase 6 [EC:2.3.2.13]
Organism
fch  Falco cherrug (Saker falcon)
Brite
Enzymes [BR:fch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102058798 (TGM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 707 aa AA seqDB search
MPEALKIENVNWHPKLNKAAHHTSDYSSTEAILRRGQAFNITLNLQTTVQAWDNLSFIAS
TGPSPTESQQTKVVFNLSEESASGWSAVLEPSEPGCMNLAISSPANAVIGRYKLKLQIVS
GNKVSSTLLGQFVLLFNPWCPNDDVFMANAKERQEYVLNDSGIIFQGLEKYIQQEAWNYG
QFEEDILDISLAILDRSLNHRQDPALDVSNRNNPVYVSRVISAMVNSNDEKGVVEGKWNG
KYRSGTNPLQWSGSVTILRKWYRGRYKPVRYGQCWVFAGVMCTVLRCLGIPTRVITNFNS
AHDRNINLSIDKYIDISGKTLHFTEDSVWNFHVWNESWFIRRDLGSFYDGWQVLDATPQE
TSKGIYQCGPASTKAIKEGDVNLDYDSSFVFAAVNADYVTWIHYSNKRKERIYSDTRKIG
KFISTKAVGSNSRVDVTANYKYPEGSLKERQVYKKALKLLGVRSTGKKAKMRRSRRRPSV
AQRQNTTQPAQKPSISGKVILDASPVIGQDILLTFALRNLLSDFKTIKVKLRASAILYTR
KPKAEILHLSRSIKLGSKEVKEIPFKISYSQYKNSLTDDRKILVTAVCETKQGASLLVEQ
DIVLQDPFLTIKVLGPTVVHKAVDVQVTFTNPLSEVVTDCVLRAEGSGLIKEQLRINVAR
MAPMESSTVQFEIIPYKSGTRQLQVDLVCIHFSDIKGFVMLDVAPVQ
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagccctgaaaatagaaaatgtcaattggcaccccaaactgaataaagctgca
caccacacctctgattacagcagcacagaagcaatcttgaggagaggacaggccttcaac
atcactctaaacctccaaacaacagtgcaggcttgggacaacctcagctttattgcaagc
acaggaccatctccaacagaatctcagcagaccaaggtcgtatttaacctttctgaggag
agtgccagtggctggagcgccgtgctggagcccagtgagcctggctgcatgaacctcgca
atatccagcccagccaatgctgtcattggacgatacaaactcaaactccaaattgtttcg
gggaacaaggtctcttcaacgctcctgggccagtttgtgctacttttcaatccctggtgt
ccaaatgatgatgtctttatggctaatgcaaaggagcgacaggagtacgtcctgaatgac
agtggaatcatatttcagggactggaaaaatatattcaacaagaagcttggaactacgga
cagtttgaagaggatattcttgatatctctctggctatactggatcgaagcctgaaccac
cgccaagatccagctcttgatgtatccaaccgaaacaatcctgtctatgtgagcagggtt
atcagtgctatggttaacagcaatgatgaaaaaggagtagtggaagggaagtggaatgga
aagtaccgctcaggaaccaaccccttgcagtggagtggaagcgtgaccatccttcgaaag
tggtacagggggagatacaaaccagtccggtatggccagtgctgggtctttgcaggagtc
atgtgcacagttctgagatgcttgggaatacctactcgtgttattacaaacttcaactct
gcccatgacaggaatataaatctgagtattgataagtacattgacatttctggaaagact
ctgcacttcactgaagacagtgtgtggaatttccatgtctggaatgaaagctggttcatt
agaagagatcttggctctttttatgatggatggcaggttctggatgcaacaccccaggaa
acaagtaaaggcatatatcagtgtggccctgcctccaccaaagccattaaggaaggggat
gtgaacctggattatgacagctcatttgtgtttgcagcagtgaatgctgactatgttact
tggattcactatagcaacaaaagaaaagagagaatttattctgatactaggaagattgga
aaatttatcagcaccaaagcagtgggctccaattcccgtgtggatgtcactgctaattac
aaatatccagaaggatccttgaaagaaaggcaggtgtataaaaaagcactgaagctgctt
ggtgtgagaagcactggaaaaaaggccaaaatgagaagatctagaagacgaccttcagta
gcacagaggcaaaatacgacacagcctgcacaaaaacccagcatctcagggaaggtgatc
cttgatgcatctcctgtaattggccaggatatcctcctcacctttgcactcaggaacttg
ctctccgatttcaagaccataaaggttaaactgagggcttcagccattctctacacaaga
aaaccaaaagcagagattttgcacttgtctaggtctattaaacttggatccaaagaagtg
aaagagattccattcaagatctcctattcccagtacaaaaactctctgacggatgacagg
aagatcctagtgactgctgtctgtgaaaccaaacagggagcctcacttctagtagagcag
gatattgtacttcaggatccttttctcaccatcaaggtccttggtccaacagtagtacac
aaggctgttgatgtgcaggttacattcaccaacccactgtctgaagtggtgacagactgt
gtgctgagagcagagggtagtggcctgatcaaagagcaactcagaatcaacgtggcaaga
atggcccccatggagagctcaacagttcaatttgaaatcattccctacaaaagtggcacc
aggcagcttcaggtggacttggtttgcatccatttttcagatattaagggatttgtgatg
cttgatgtggctcctgtgcaatga

DBGET integrated database retrieval system