KEGG   Falco cherrug (Saker falcon): 102059273Help
Entry
102059273         CDS       T02911                                 

Gene name
SRD5A3
Definition
steroid 5 alpha-reductase 3
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102059273 (SRD5A3)
Enzymes [BR:fch01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     102059273 (SRD5A3)
    1.3.1.94  polyprenol reductase
     102059273 (SRD5A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 341 aa AA seqDB search
MKKKRKMTKRMEKGRCPKRPPEDPRPIRPHMCKVLFWRYRWGMEERRCCSHTEAICAKLE
QKPHPVNPSAMWYLQNKPSRRAQPGVLGLWVPECQTYCRWFTHFYVVSVFWNGFLLICLF
QAKFLGGLLPSWIQCVHRALGRDSQSEDIDSEHFSALLVLLLLWLHSCRRLAECLWTSVF
SNGVINIVQYCFGLVYYVAVGSTVLCQVPTNVRNGKELSVQISWYHIVGVMMYIWASLHQ
HRCLVILANLRKSKSGNVVSLSHNVPFGDWFERVSCPHYFAELLIYVSMAIMLGFHNVTW
WCVVLYVLFNQALAAVLCHEFYHKNFSSYPKHRKAFIPFVF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaagaggaagatgacaaagaggatggagaaaggaagatgtcccaaacgacca
ccagaggaccctcgacccatcaggccacacatgtgtaaagtgttattctggcgttacaga
tggggaatggaggagcgtagatgctgcagtcatacagaggccatatgtgccaaactggaa
caaaagcctcatcccgtgaatcccagtgccatgtggtatctgcagaacaaaccttcccgc
agggctcagcccggggtcttggggctgtgggttcccgagtgtcaaacatactgtaggtgg
tttactcacttttatgtggtttctgtgttctggaacggctttctgctgatctgtcttttc
caagccaagttcctcggagggttgctcccatcatggattcagtgcgtgcaccgtgctctt
ggcagagattctcagagtgaggacattgatagcgagcacttctctgcgctgctggttctc
ctgctgctttggctgcatagctgtcgaagactggcagaatgcctctggaccagtgtgttt
tccaatggtgtcattaatatcgtgcagtattgctttggacttgtttactacgttgctgtt
ggctcaactgtgctatgtcaagtgcctactaatgtcaggaatggaaaagagctttctgtg
cagatctcctggtatcacattgtgggagttatgatgtacatttgggcctctcttcaccaa
cacagatgtcttgtaattctagctaatcttagaaaaagtaaatcaggaaatgttgtaagt
ctgagccacaatgtaccttttggagattggtttgagagagtttcttgccctcattatttt
gcagagctcctcatatatgtatctatggctatcatgcttggatttcacaacgtgacgtgg
tggtgtgtagtgttgtatgttctttttaaccaagcactggctgctgttttgtgtcacgag
ttttatcataaaaactttagctcctacccaaagcatcgaaaagcatttataccatttgtt
ttttag

DBGET integrated database retrieval system