KEGG   Falco cherrug (Saker falcon): 102059381Help
Entry
102059381         CDS       T02911                                 

Gene name
C1GALT1
Definition
core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102059381 (C1GALT1)
Enzymes [BR:fch01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     102059381 (C1GALT1)
Glycosyltransferases [BR:fch01003]
 Glycan extension
  Type 3 chain
   102059381 (C1GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 366 aa AA seqDB search
MASSKSLMNLLTFTFGSAIGFFVCYLLFSIILEEQVKIQPHVLHNDPHGQHSADIDNNQL
QGQMNFNADSGQHKDENKNIAEGLYQKVKILCWVMTGPQNLEKKAKHVKATWAQRCNKIL
FMSSEENKDFPTVGLETKEGRDQLYWKTIKAFQYVYDHYFDDADWFMKADDDTYVILDNL
RWLLSKYSPEQPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVAAFKTNKCSHSSSIE
DLALGKCMEIINVEAGDSRDTSGRETFHPFVPEHHLIRGYLPKTFWYWNYNYYPAVEGPG
CCSDLAVSFHYVDSMTMYHLEYLIYHLRPYGYLYRYNPDLTKSLEEQSKNEALEDKQKLK
QKISEN
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttctaagtctttgatgaaccttctaaccttcacttttggatcagcaatagga
ttttttgtgtgctatcttctgtttagcattatactagaagaacaggttaagatccagcct
catgtccttcacaatgatccacatggtcaacactcagcagatattgataacaatcagctg
caaggacaaatgaatttcaatgcagactctggacagcataaagatgagaataaaaatatt
gcagagggactgtatcagaaggtgaaaatactgtgttgggtcatgactggtcctcaaaat
ctagaaaagaaagccaagcatgttaaggccacttgggcccaacgttgtaataaaatactt
tttatgagctctgaggaaaataaagacttcccaactgtggggctagaaaccaaagaaggc
agggaccaactgtactggaagactattaaagcttttcagtacgtatatgaccattatttt
gatgatgctgattggtttatgaaagcagatgatgatacatatgttatattggacaatttg
aggtggcttctttcaaaatacagtcctgaacaaccaatatactttggaagaaggtttaag
ccatatgtgaaacagggctacatgagtggaggagcaggatatgttctgagcaaagaagct
ctgaagagatttgttgctgcatttaaaacaaacaaatgctctcacagttcctctatcgaa
gacctagcattaggaaaatgcatggagatcattaatgtggaagcaggagattctagggat
acaagtggcagagaaacctttcatcccttcgttccagaacatcacttaatcagaggatac
ctaccaaaaacattctggtactggaattacaattattacccagctgtagagggtcctgga
tgctgctctgatctagcagtttcattccactacgttgactccatgactatgtatcatttg
gaatatttgatttatcatctccgtccatatgggtatttgtatcggtacaatcctgatttg
acaaagagtctggaagagcagagcaaaaatgaagcactggaagacaaacaaaagctaaag
caaaaaatctctgagaattaa

DBGET integrated database retrieval system