KEGG   Francisella cf. novicida 3523: FN3523_0473Help
Entry
FN3523_0473       CDS       T02078                                 

Definition
1,4-alpha-glucan branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fcn  Francisella cf. novicida 3523
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fcn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FN3523_0473
Enzymes [BR:fcn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     FN3523_0473
Exosome [BR:fcn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FN3523_0473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(466390..468312)
Genome map
AA seq 640 aa AA seqDB search
MKNKNSKQSYDVAIGDQDKYYFHEGKHIYAYNFMGAHKTHENGVDGIRFTTWAPNAKSIC
VIGDFSHWEIQENNYMSAISEAGLWSVFISNAKNGDKYKFVVTNKDSNHYVYKSDPYAFF
AELRPNTASIITTETQYIWSDDKWLEKRAKTNYYDNPMNIYELHLASWKTKDGKFMTYDE
LSETLPEYIKKMGYTHVEFMPLHEHPLDASWGYQPTGFYSVNSRHGDIIGLKRLVDKLHN
NDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPTKAINKGWGTHNFDLGRNEVKCFLI
SNAMYWISEFHIDGLRVDAVSNILYLNYDREDGQWIPNIYGGHENLEGIAFLKELNGVLK
HTCKGVVTIAEESSSWPDISTPVEKGGLGFDFKWNMGWMNDTLRYISLDPVYRKYHHNLI
TFSMVYHYSEKFILSISHDEVVHGKKSLINKMWGDLWNKYAGLRLYMSYMIGHPGKKLIF
MGSEFGQFVEWREYEQLQWQIVDQYDTHKQTIYFFKKLNDFYRNETALWQCDYEHHGFRW
IDADNSQQSILSFVRSSKDDKQKLIFICNFTPVTYYDYHLGVPDVGSYKEVFNSDSLEFG
GSGQVMSTEIFTSPQSSHGFEQRITIKIPPMATLVLKLIK
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaaaattcaaaacaaagttatgatgttgctataggtgatcaggataaatat
tactttcacgaaggcaaacatatatatgcttataattttatgggagctcacaaaactcat
gaaaatggggttgatggtataagatttactacttgggctcctaatgccaaaagtatctgt
gttatcggtgattttagtcactgggaaattcaagaaaacaactatatgagtgctattagt
gaagcaggattatggagtgtttttatatcaaatgcaaaaaatggtgataaatataagttt
gtagtaactaacaaagatagtaatcattatgtctataaaagcgacccttatgcttttttt
gctgaattaagaccaaatacagcttctataattactactgaaactcaatatatctggagt
gatgataaatggctagaaaagcgcgctaaaactaactactatgataatcccatgaatatt
tatgagctacatttagcttcatggaaaactaaagatggtaaattcatgacatatgatgag
ctaagtgaaactctacctgaatacattaaaaagatgggctatactcatgttgaatttatg
cccttacatgagcatccactagacgcttcgtggggctatcagcctactggcttttattct
gtaaatagccgtcatggtgatataattggcttaaagcgactagtagataagctgcacaat
aatgatataggtgtaattctagattgggtaccaggacatttctgtaaagatcagcatggt
ttaatatactttgatggaagtccatgctatgagtatcaagaacctacaaaagcaatcaat
aaaggctggggaacacataattttgacttaggcagaaatgaagtaaaatgcttcttgatc
tcaaatgcaatgtactggatcagtgagtttcatatagatggtttgcgtgttgatgcagta
tcaaatattctttatcttaattatgatagagaagatggtcaatggatacctaatatttat
ggcggtcatgaaaaccttgaaggtatagcttttcttaaagaactaaatggagttctaaaa
cacacctgcaaaggagttgttactattgctgaagaatcttcctcctggccagatatttca
actcctgttgaaaaaggtgggttaggatttgactttaaatggaatatgggatggatgaat
gataccttaaggtatatctcactagatcctgtttatcgcaaatatcatcacaacttaatc
actttctctatggtataccactattcagagaaatttattttgtctatctctcatgatgaa
gttgtacatggcaagaaatctttgattaataaaatgtggggggatctgtggaataaatat
gcaggacttcgcttatatatgtcatatatgattggccatcctggtaaaaagcttatattt
atgggtagtgagtttggtcaatttgttgaatggcgtgaatacgaacaactccaatggcaa
atagttgatcaatacgatactcacaaacaaactatttactttttcaaaaagttaaatgat
ttctaccgtaatgaaactgcactgtggcagtgtgactatgaacaccacggttttagatgg
atagatgccgataattcgcagcaaagtatcctatcttttgttagaagtagtaaagatgat
aaacaaaagttaatatttatttgcaattttaccccagtaacttactatgattaccatcta
ggagttccagatgtgggatcatacaaagaggtatttaactcagatagtcttgaattcggt
ggttcaggacaggttatgagtacagagattttcacatcaccacagtcatcacatggattt
gagcaaagaatcacaatcaaaatccctcctatggcaacactcgtactcaaacttatcaaa
taa

DBGET integrated database retrieval system