KEGG   Francisella cf. novicida 3523: FN3523_0478Help
Entry
FN3523_0478       CDS       T02078                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
fcn  Francisella cf. novicida 3523
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fcn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FN3523_0478
Enzymes [BR:fcn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     FN3523_0478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
475452..476915
Genome map
AA seq 487 aa AA seqDB search
MRKAGLLLAISSLPSQFGIGDLGKSAYEFVDIIKQANTKIWQVLPLTPLGFGNSPYQSSS
SFAGDEIYISLEKLADYGLLEESSLKKLNVNSDKVEYELVRNFKDKYLEEAFSNFQSSKD
KFEQEYNDFITQNSWVKNYAIFKAFRKANNNQAWNLWPQEYKNWIKEKAIELNQFQQEID
YQIFLQFIFYKQWFELRNYANKNNIEIMGDLPIYLGFDSADVWEHQDIFLLDENQNPSFV
AGVPPDFFSETGQLWGNPLYDWDKLKQTNFDFWIDRLNGNFKLFDIVRIDHFRAFDTYWK
IPAGEKTAINGEWVEAPGYDFFDIVYKRIPDANIIAEDLGDLRPEVFELRDHYNLKGMKV
FPFHFDLKTGSFIDDANIVAYSGTHDNNTLKGWYFDELNRYQRKLLKRYFKANDKNIFSK
IIKYLLSCEAEYVILPVQDILELDGHARLNTPGTVGEPNWQWKLADFNLLNSKTNRLAKQ
ISKSINH
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagctggattattattagctatttcaagtttgcctagccagtttggtattggt
gacttgggtaaaagtgcttatgaatttgttgatattataaaacaagcaaatactaagatt
tggcaggtattaccacttacaccattaggcttcggtaactcgccatatcagtcgagctct
tctttcgctggtgatgaaatctatattagcttagaaaaactagcagattatggtttgctt
gaagaatcatctcttaaaaaactaaatgtaaactctgacaaagtcgaatatgaacttgtt
cgtaatttcaaagataagtatcttgaagaagcatttagcaattttcaaagctcaaaagat
aagtttgaacaagagtataatgattttataactcaaaactcttgggttaaaaactatgct
atttttaaagcttttagaaaggctaataataaccaagcttggaatttgtggccgcaagaa
tataaaaactggattaaagagaaagctatagaacttaatcaatttcaacaagagatagat
tatcaaatatttttacagtttatcttttataagcagtggtttgaattaaggaattatgct
aataaaaataatattgaaattatgggtgatttacctatctatttaggttttgactctgct
gatgtctgggagcatcaagatatattcttgttggatgagaatcaaaatcctagttttgtt
gcaggtgttccacctgactttttctcagaaactggtcaactatggggtaatcctctatat
gattgggataaactcaaacaaacaaactttgatttttggatagatcgactcaatggcaac
ttcaagctatttgatattgttagaattgatcattttagagcatttgatacttattggaaa
atcccagcaggtgaaaaaactgctataaatggtgagtgggttgaggctcctggttatgat
ttctttgatatagtctataagcgtattccggatgctaatattattgctgaagatttaggc
gatttacgaccagaggtgtttgagttgagagaccactataaccttaaaggtatgaaggtt
tttccatttcactttgatctaaaaactggtagttttattgatgatgcaaatattgttgct
tactctggaactcatgataacaatactctcaaaggatggtattttgatgaactaaatcgt
tatcagagaaaacttttgaaacgatatttcaaagctaatgataaaaatatctttagcaaa
ataattaagtatttgcttagctgtgaagctgaatatgtaattctaccagtacaagatatt
ttagagttagatggtcatgctcgactaaatactccaggtacagttggagaacctaattgg
caatggaagttagctgattttaatttacttaattcaaaaactaatcgcttagctaaacag
atatctaagtctataaatcattaa

DBGET integrated database retrieval system