KEGG   Francisella cf. novicida 3523: FN3523_0955Help
Entry
FN3523_0955       CDS       T02078                                 

Definition
GTP cyclohydrolase I type 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fcn  Francisella cf. novicida 3523
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fcn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FN3523_0955
Enzymes [BR:fcn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     FN3523_0955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
980375..980989
Genome map
AA seq 204 aa AA seqDB search
MKDKYCSKLGKSVQQHLIKLGLEQPREFNSDSDNKIAIIAKAYRQILDALGLHTHEFEKT
PFRVARMFSQEIFNGLDYANFPACALYENEFNYTGILTQKDITIMSFCEHHFVPFEGTAE
VSFIPNNNNIIGLCRINSICDFFSRRPQIQERMTAQIFETLKFILATEDVSVKIKAKHTC
VSFRGVNNQSSETYTEMLGGSFAK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacaaatactgctctaaattaggtaaaagtgtccagcaacatctcatcaaacta
ggtctagagcaacccagagaatttaattctgatagtgataataaaatagccataatagcc
aaagcatatcgacaaatcttagatgctcttggtctacatacacatgagtttgaaaaaact
ccttttagagtagcaagaatgttttcccaagaaatattcaatggtcttgattatgctaat
tttccggcctgtgctttgtatgaaaatgagtttaactataccggtattctaactcaaaaa
gatataactattatgtcattttgtgagcaccattttgtcccttttgaaggcactgccgaa
gtttcttttattcctaacaataataatattataggactttgtcgaataaacagtatttgt
gacttcttttccagacgcccacaaattcaggagcgaatgacagctcaaatatttgagacc
ttaaaatttatcttagcgacagaagatgttagtgtgaagattaaggctaaacatacttgt
gtttcatttagaggagtaaataatcaaagctctgaaacatatactgaaatgcttggtggt
agttttgctaaatag

DBGET integrated database retrieval system