KEGG   Francisella cf. novicida 3523: FN3523_1527Help
Entry
FN3523_1527       CDS       T02078                                 

Definition
Fatty acid desaturase; Delta-9 fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
fcn  Francisella cf. novicida 3523
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fcn00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    FN3523_1527
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    FN3523_1527
Enzymes [BR:fcn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     FN3523_1527
Lipid biosynthesis proteins [BR:fcn01004]
 Desaturase
  First
   FN3523_1527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1578899..1579729
Genome map
AA seq 276 aa AA seqDB search
METQSNKLTIIAFAIMHLACLAIFFVNYNITALVVFLVTFSARTFALTAGYHRYFAHKAF
QTSRGFQFILALVGTWASQKGPLWWSGHHRYHHIHSDKDTDLHSPKNGIFQSHVGWVFES
RSDHVDPKFTKDWVKYPELVWIDKYAHVSFALYLVGLFALGSLVSHFYPRLETSGLAFVF
WGGILSTVLLYHTTFSVNSICHIFGSKDYETSDNSRNNWFIALITFGEGWHNNHHKFAYS
VRNNLKVWQIDITYMILCVLRKFRIVWDFKQPKKTI
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacagtctaataaactgacgataatagcatttgctattatgcacttagcctgt
ttggcaatattttttgtaaattataatattacagcgctagttgtatttcttgttacattt
tcagctagaacatttgctttgacagctggatatcatcgttactttgcacacaaagctttt
caaacctctagagggtttcaatttatcttagcattagtaggtacttgggcgtctcaaaaa
ggaccgctttggtggtcaggacatcatagatatcatcatatccattccgataaagataca
gatctacactcgcctaaaaatggtatctttcaatcacacgtaggctgggtttttgaatct
agaagcgaccatgtagatccaaaatttaccaaagactgggttaaatatcctgagctagta
tggatagataaatatgctcatgtatcatttgctctatatctggtagggctttttgcttta
gggagcctagtcagtcacttttatcctagacttgaaacatctgggctggcatttgtcttc
tggggagggatactaagtaccgtcttgctataccataccacttttagtgtaaactcaatt
tgccatatttttggctctaaagattacgaaacttcagataatagtcgcaacaattggttt
atagctctaattacatttggtgaaggttggcataataatcatcataaatttgcttactcg
gttagaaataatcttaaagtgtggcaaatagatattacctatatgattttatgtgtcttg
agaaagttcagaatagtttgggattttaaacaaccaaagaaaacaatttag

DBGET integrated database retrieval system