KEGG   Francisella cf. novicida 3523: FN3523_1629Help
Entry
FN3523_1629       CDS       T02078                                 

Definition
Fatty acid desaturase; Delta-9 fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
fcn  Francisella cf. novicida 3523
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:fcn01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:fcn01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1687621..1688787)
Genome map
AA seq 388 aa AA seqDB search
MNNNEMIHQTIEKQGSIVWKSVFGLLLLPLVALIAIPWYAMTYGFSTSDYVCLVVFYMLT
GVGITMGYHRLWSHKTYKANKIVSYALLLFGTAALQNSVIQWSSDHRKHHKDVDDPIKDP
YAATRGFWFSHFGWLLRHSSPDVQEIRGVNDLLKDKALVFQHNHYTVLAILSCFGLPALL
GFIFGFLSGHTLTAAWHSALGFLLLGGLLRVILVHHATFCINSLAHTIGKRPYSTKNTAR
DSWITAIVTGGEGYHNYHHAFAGDYRNGIRWFDLDPSKWFIAGLAKIGWCYDLKTTPKHL
IEIAKAKVKLEEALTKKNKTFHLGIEEKYAKLVANVKNMYNAKQEYLKAKKDNVLSKADI
KEIKSKYKDLKIEFIQAKKKYNKASTIA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaataataatgaaatgatacaccaaaccatagaaaaacaaggtagcatagtctggaag
agtgtttttgggttgctacttctaccattggtagcgcttatagctattccttggtatgct
atgacttatggcttttcaacatcagactatgtatgtttagtagtcttctatatgcttact
ggtgttggtattacaatgggttaccatagactgtggtcacacaaaacatataaggcaaac
aaaatagtaagttatgctcttttattatttggcacagctgcgctacaaaatagtgtaatt
caatggtcttcagatcacagaaaacaccataaagatgttgatgatcctatcaaagatcca
tatgctgctacacgtggtttctggttttcacattttggttggttactaagacatagtagt
cctgatgttcaagagatcagaggtgtaaatgatcttctaaaagataaggcactagtattc
cagcataatcattacactgttttagcgatattatcgtgttttgggttgcctgcattgcta
ggttttatattcggattcttgagcggtcatacacttacggctgcttggcacagtgctttg
ggttttttactgttaggcggtctacttagagttatattggttcatcatgcaactttttgt
atcaattctttagcacatactattggtaaaagaccttattctacaaaaaatactgctagg
gatagctggataacagctatagtaacaggcggtgagggttatcataattatcatcatgct
tttgctggcgattatagaaatggtattagatggtttgatttagacccatctaagtggttt
attgctggcttagctaagattggctggtgttatgatcttaaaacaacacctaagcattta
attgaaattgctaaagcaaaagttaaattagaggaagcattaactaagaaaaataaaact
ttccatctaggtattgaagagaagtatgctaagcttgttgcaaatgttaaaaatatgtat
aacgctaagcaagagtacttgaaagctaagaaagataatgtattgtctaaagctgatatt
aaagaaattaaatcaaaatataaagatttaaaaattgagtttatccaagctaagaaaaaa
tataataaagctagtactattgcctaa

DBGET integrated database retrieval system