KEGG   Francisella cf. novicida 3523: FN3523_1840Help
Entry
FN3523_1840       CDS       T02078                                 

Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
fcn  Francisella cf. novicida 3523
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:fcn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FN3523_1840
Enzymes [BR:fcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     FN3523_1840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1930522..1931442)
Genome map
AA seq 306 aa AA seqDB search
MSVVVIGSANRDLVVKVDQLAQKGQTIISQNYEEFCGGKGANQAVAARRLGENVTFITNL
GKDSFGDRLLEFYKKEGLDSSTINQDEASNTGLAFICVDNQGQNIINVVMGANAKLDQQI
LDKHNQKIQQANIILTQLETPLETIEYLANKITEEQTFILNPAPARELPQQLLKKVDILT
PNETEASILSGIQVKDLETAKQAAKILHEQGVAIVIITLGEQGALLSKNNRQEQKLFATK
KVDVVDTTAAGDTFNGVLAFCLDKGLSIEQSIEIANTAAALAVTVEGAEDSAPTLEKLNT
YLEQKI
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtagttgttataggaagtgctaacagggatttagttgtaaaagttgatcaactt
gcgcaaaaaggtcaaacgataataagtcaaaattatgaagagttttgtggtggtaaagga
gctaatcaagctgtagccgcaagaagactaggtgaaaatgtaacttttattacaaatctt
ggtaaagacagttttggagataggcttttagagttttataaaaaagaaggtttagatagt
tcaactatcaatcaagatgaagctagtaatacaggtttggcttttatttgtgttgataat
cagggtcaaaatataattaatgtagtaatgggtgctaatgctaagttagatcagcaaatt
ttggataagcataaccaaaaaatccaacaagctaatatcatactaactcaactagaaacc
cctttagaaactattgagtatttagcaaataaaatcacggaagaacaaacttttatatta
aaccctgccccagcaagagaactacctcaacaattactcaaaaaggtagatattttaact
ccaaatgagactgaggcatctatcctttctggtatacaagtcaaagatttagaaacagct
aaacaagcagcaaaaatattacatgagcaaggtgtcgctatagtaataataactttgggt
gagcaaggtgctctattatcaaaaaataatcgacaagaacaaaaattatttgctactaaa
aaagtagatgtagttgatactactgctgctggagatacttttaatggtgttttggcattt
tgtctagacaaaggactatctatagagcaatcaatcgagatagcaaatacagcagcagct
ctagcagtaaccgtagagggagcagaagattctgcacctactttagagaaactaaatact
tatttagaacaaaaaatataa

DBGET integrated database retrieval system