KEGG   Flavobacterium columnare: FCOL_00395Help
Entry
FCOL_00395        CDS       T01653                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
fco  Flavobacterium columnare
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    FCOL_00395
Enzymes [BR:fco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     FCOL_00395
Exosome [BR:fco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FCOL_00395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
91264..92751
Genome map
AA seq 495 aa AA seqDB search
MSNYILSLDQGTTSSRSILFDLKGNVVAVSQKEFSQIYPIPGWVEHDPIEIWESQLTTIF
EVLEKAQIKSSEIKAIGITNQRETTVLWDKTTGMPIYNAIVWQDRRTAVFCDDLKSRGLN
NIIQQKTGLVVDSYFSGTKVKWILDHVEGARTKAEQGQILFGTIDTWLLWNLTQGKVHAT
DVSNASRTLFCNIHNCEWDEELLEILDIPTSILPQICSSSEIYGYTNVLDSAITIPIAGI
AGDQQAALFGQMCIQPGMVKNTYGTGCFMLMNTGKELIPSQNHLLTTVAWKINGVTHYAL
EGSVFIAGAVVQWLRDGLGIIESSEDVETLAEKVPTTEGVYVVPAFAGLGAPYWNQHARG
TIAGLTRGTTAAHIARASLESIAYQTRDVLLAMQADSHIYIKELRVDGGATVNNLLMQFQ
ADVLNSKVIRPIITETTALGAAYLAGLAVGFWKSIEELQQQWQVEKVFTSTMEPELRNSL
NEGWKKAINASVAFI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaattatattttatcattagatcaaggaactacaagtagccgctctattttattt
gatttaaaaggaaatgttgtagcggtatctcagaaagaattctctcagatttatcctata
ccaggttgggtagaacatgatcctatagaaatttgggaatcacaacttacaactattttt
gaagtgttagaaaaagcacaaattaaaagttcagaaataaaagccataggtataaccaat
cagcgcgaaaccacagtattatgggataaaaccacagggatgcctatttataatgcaatc
gtttggcaagatagaagaacagctgttttttgtgatgacttgaagtctagaggactcaat
aatataattcaacaaaaaacaggtttagtagttgattcctactttagtggaactaaagta
aaatggattctagatcatgttgaaggagcaagaacaaaggctgaacaaggacaaatctta
ttcgggactattgatacttggttactttggaatttaactcaagggaaagttcatgctacc
gatgtaagtaacgcaagccgtaccctattttgtaatattcataattgcgaatgggatgaa
gaattattggaaatattagatattccaacgagtattttacctcaaatctgtagcagtagc
gaaatttatggttatacaaatgttttagattcagcaattactattccaatagcaggaata
gcaggagatcaacaagcagccttatttggtcaaatgtgtattcaaccaggaatggtcaaa
aatacatacgggacaggatgttttatgttaatgaatacaggtaaagaattaattccttcc
caaaatcatttgttaacaaccgttgcttggaaaataaatggagtgacacattacgcatta
gaaggaagcgtttttattgcgggtgccgttgttcaatggttgcgcgatggtttaggtatt
atagaatcttcagaagatgtagaaacattggctgaaaaagtaccaactacagaaggggtt
tatgtagtgcctgcctttgctggtttaggagcaccttattggaatcagcatgcaagagga
actattgcaggattgacaagaggaactacagccgctcatatagccagagcttctttagaa
agcatagcctatcaaacacgcgatgtattattagcaatgcaagcagatagccatatttat
ataaaagaattacgtgtagacggaggtgctacagttaataatttacttatgcaatttcaa
gccgatgtattaaatagcaaagtaataagacctatcattacagaaaccacagccctagga
gctgcttacttagctggtttagccgttggtttttggaaaagtatagaggaattacaacaa
caatggcaagtagaaaaagtatttacctccacaatggaacctgaattacgaaattctttg
aacgaaggttggaaaaaagctattaacgcatccgtagcatttatatag

DBGET integrated database retrieval system