KEGG   Flavobacterium columnare: FCOL_01025Help
Entry
FCOL_01025        CDS       T01653                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fco  Flavobacterium columnare
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FCOL_01025
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FCOL_01025
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FCOL_01025
Enzymes [BR:fco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FCOL_01025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(250694..251875)
Genome map
AA seq 393 aa AA seqDB search
MKYTVNEKGFYGDFGGAFIPEMLYPNVEQLRQQYLDIIETESFQQEYLELLKDYVGRPTP
LYFAKNLSEQYGTNIYLKREDLCHTGAHKVNNTIGQILLAKRLGKHRIIAETGAGQHGVA
TATVCALMGLQCIVYMGEIDIKRQAPNVARMKMLGAEVRPATSGSKTLKDATNEAIRDWI
NNPLDTFYIIGSVVGPHPYPDMVARFQSIISEEIRKQLLEKEGRETPDYVIACVGGGSNA
AGAFYHFLDDENVNLIAVEAAGKGIYSGESAATSILGKEGIIHGSKTLLMQTEDGQITEP
YSISAGLDYPGVGPLHAHLFKSGRATFMSATDDEAMQAGLNLCKKEGIIPAIESSHALAI
FDLKKFKKEDIVVINLSGRGDKDLNTYISYFEL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatacagtaaacgaaaaaggattttatggtgattttggaggggcttttatccca
gaaatgctgtatcctaatgtagagcagttacgccaacagtaccttgatataatcgaaacg
gagagtttccaacaagaatatttagaattattaaaagattatgtaggtcgccctacccct
ttgtattttgctaaaaatttatcggagcaatatggcaccaatatctatttaaagcgagaa
gacttatgccatacaggtgcgcataaagtcaacaataccattggtcaaattttattagcc
aaacgattaggcaaacaccgcatcatcgccgaaacgggtgctggtcaacacggcgtagca
accgccaccgtttgtgccttaatgggattacaatgtattgtgtatatgggcgaaatcgac
atcaaacgccaagcgcccaatgtagcccgaatgaaaatgctcggtgctgaagtccgtcct
gccacctcaggttcaaagaccttaaaagatgcgacgaatgaagccattcgcgattggatt
aacaatccgctagataccttttacatcataggatcagtagtaggacctcatccctaccct
gatatggtagcccgttttcagagtattatttcggaagaaattagaaaacaattattggaa
aaagaaggtcgagaaacccctgattatgtcattgcttgtgtaggtggaggaagtaatgcc
gctggcgctttttatcatttcctagacgatgaaaatgtcaatttaatagcagtagaagcc
gcaggaaaaggaatttattcaggcgaaagtgccgctacctccatattaggcaaagaaggc
attatccacggaagcaaaaccctattaatgcaaaccgaagacggtcaaatcaccgaaccc
tattctatttcggcaggattagattacccaggtgtgggccccttacacgcccatttattc
aaaagcgggagagccacttttatgtcggctaccgatgacgaagcgatgcaagcaggcctt
aacctatgtaaaaaagaaggcatcattccagccattgaaagttcgcacgctttagccatt
tttgacttaaaaaaattcaagaaagaagatattgtagtcattaacctttcaggaagagga
gataaagatttgaatacgtatatcagttactttgaattataa

DBGET integrated database retrieval system