KEGG   Flavobacterium columnare: FCOL_01505Help
Entry
FCOL_01505        CDS       T01653                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fco  Flavobacterium columnare
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fco00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(360852..361523)
Genome map
AA seq 223 aa AA seqDB search
MAHNEEFHDELGHSHIATSATTPLRSDAFDLSDEEKIASIRKDVESILKTLGMDLTDDSL
SGTPNRVAKMFVKDIFGGLNPDKKPGSSTFLNHYKYNEMLVEKNIVVYSTCEHHLLPIIG
RAHVAYISNGTVIGLSKMNRIVDYYAKRPQVQERLTMQIVQELQNVLGTDDVACVIDAKH
LCVNSRGIKDIESSTVTAEFGGKFKNEATRKEFLDYIKLETKF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggctcataacgaagaatttcacgacgaattaggacacagtcatatagcaactagcgcc
actacccctttgcgtagtgatgcttttgatttatcagacgaagaaaaaattgcttcaatc
cgtaaagatgttgaaagtattttaaaaactttgggaatggatttaacagatgatagccta
agcggtacccccaatcgtgtggcaaaaatgtttgttaaagatatttttggaggcttaaac
ccagataaaaaaccaggatcttcaactttcctaaaccattataaatacaatgaaatgttg
gtagaaaaaaacattgtcgtttactctacttgtgaacatcaccttctaccaattattggt
cgtgcacatgttgcttacatttctaatggtactgtaatagggctttctaaaatgaatcgt
atagtagattactatgcaaaacgaccacaagtacaagaacgtttaaccatgcaaatcgta
caagaattacaaaacgtactaggtactgatgacgtagcttgtgtaatagatgccaaacac
ttgtgcgtaaactcacgcggtattaaagatatagaaagcagcacagttactgctgaattt
ggtggtaaattcaaaaacgaagcaactcgtaaagaatttttagactatataaaattagaa
actaagttttaa

DBGET integrated database retrieval system