KEGG   Flavobacterium columnare: FCOL_02160Help
Entry
FCOL_02160        CDS       T01653                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fco  Flavobacterium columnare
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FCOL_02160
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FCOL_02160
   00620 Pyruvate metabolism
    FCOL_02160
   00640 Propanoate metabolism
    FCOL_02160
  Energy metabolism
   00680 Methane metabolism
    FCOL_02160
Enzymes [BR:fco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     FCOL_02160
Lipid biosynthesis proteins [BR:fco01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   FCOL_02160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
496713..498620
Genome map
AA seq 635 aa AA seqDB search
MSYYTIKDLENYFKMYKKSVREPKKFWDKIADENFIWYQKWDKVFDFDMQKAEFKWFIDA
KVNITKNCIDRHLARRGDKTAIIFEPNNPEEKAQKISYNELYQKVSKMANVLLEQGIEKG
DRVCIYLPMIPELAIAVLACARIGAIHSVIFAGFSAGALEARINDCQAKMVITSDGGYRG
DKKINLKGIVDEALERCHGVKTVLVVERTKEKIDMKIGRDHWLQPLLDNALDTSVAEIMD
AEDPLFILYTSGSTGKPKGMLHTTAGYMVYTAYTFKNVFNYNDGDIFWCTADIGWITGHS
YSLYGPLLNGGTTVISEGILSYPDFSRYWQIIEKHKITQFYTAPTAIRSLAKENLDYVQK
FPLKSLKVIGSVGEPINEEAWHWYNDHVGGKRCPLVDTWWQTETGGIMIAPIPFVTPTKP
TYATLPLPGVQPVLMDELRNEIEGNQVVGSLCIKFPWPSIARTIWGDHERYKETYFSQFP
GKYFTGDGALRDEVGYYRITGRVDDVIIVSGHNLGTAPIEDSINEHPAVAESAIVGFPHD
IKGNALYGFVILKETGEHRDRENLKIEINQIISDQVGPIAKLDKIQFVSGLPKTRSGKIM
RRILRKIASGDLENFGDISTLLNPEVLEEIKNEKV
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgagttattataccataaaggatttagaaaactactttaaaatgtataaaaaatcggta
cgagaacccaaaaaattttgggataaaatagccgatgagaattttatctggtatcaaaaa
tgggataaggtttttgattttgatatgcaaaaagcagaatttaaatggttcattgatgca
aaagttaatataacaaaaaactgtattgatcgccacttggctagacgtggagacaaaaca
gcaattatttttgaacctaataaccccgaagaaaaagcacagaagataagttacaacgaa
ctttatcaaaaagtttcaaaaatggctaatgttttgttagaacaaggcatagaaaaagga
gatcgcgtatgtatttatttacccatgatacctgaattagccatagccgttttagcttgc
gcaagaataggtgctattcattctgttatttttgcaggtttttcagcaggtgctttggaa
gctcgtataaatgattgtcaagcaaaaatggtgattacatctgatggaggttatagaggt
gataaaaaaatcaatctaaaagggattgtagatgaggcactagaacgttgtcacggtgtt
aaaaccgttttagttgttgagcgaaccaaggaaaagatagatatgaaaataggacgtgat
cattggttacaacctttattagacaatgctttagacactagtgtggctgaaataatggat
gctgaagatccattatttatcttatatacttcaggttctacaggaaaaccaaaagggatg
ttacatacaacagctggatacatggtttacacagcttatacatttaaaaatgtttttaat
tataatgacggagatatattttggtgtaccgcagatataggttggattacaggacattct
tattcattatacggacctcttttaaatggtggaacaaccgtaatcagtgaagggatattg
tcatatcccgatttttcacgttattggcaaataatcgaaaaacataaaataacacaattt
tatacagctcctacagccattcgttctttagccaaagaaaatttagactatgtacagaaa
tttcctttaaaatcattaaaagtaataggttcagtaggagaacctattaatgaagaagct
tggcattggtataatgaccatgtaggagggaagcgttgtccactagtagatacatggtgg
caaacagaaacaggtggaattatgattgcacctataccttttgtaactcctactaaacct
acttatgccaccttgccattaccaggagtacaacctgttttaatggatgaattaagaaat
gaaatagaaggaaatcaagttgtaggaagtttatgtattaaatttccttggccaagtatt
gccagaactatttggggagatcatgagcgatataaagaaacttatttttctcaatttcct
ggaaaatactttactggtgatggagcattacgtgacgaagtgggatattatagaataaca
ggtagagtagatgatgttattattgtttcaggacataatctaggaacagctcccattgaa
gattctattaatgaacatccagctgtagcagaaagtgctatagtaggatttcctcacgat
ataaaaggaaatgctttatatggttttgtcattttaaaagaaacaggagaacatcgggat
cgtgaaaatttaaaaattgaaataaatcaaatcatttcggatcaagtaggacctattgct
aagttagacaaaattcaatttgttagtggtttacctaagacccgttcaggtaaaattatg
cgtagaattttaagaaaaatagcttctggtgatttagaaaattttggagatatttctacg
ttattaaacccagaagttcttgaagaaattaaaaacgaaaaagtttaa

DBGET integrated database retrieval system