KEGG   Flavobacterium columnare: FCOL_02395Help
Entry
FCOL_02395        CDS       T01653                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
fco  Flavobacterium columnare
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FCOL_02395
Enzymes [BR:fco01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     FCOL_02395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(555070..556755)
Genome map
AA seq 561 aa AA seqDB search
MVNSMEQKSFPFTAISAQDDFKLALLLCMIDPSLGGVLVQGDKGTGKTTTVRALQGLMKN
IEPHFPFVNLPIGATEDRVLGSIQLETLINEKRLEVQKGLLSKAHQGILYIDEVNLLNDY
LMDVLLDASSSGGYFLERDSISQWLDSRFCLVGTMNPEEGDLRPQLLDRFGLAVTIKTPT
DKKIRMEIVNRRLKFDLDSNEFYHEFEDQEKQLANQITSARKQLSNIHLSEEIRETIAEK
CIAYQVEGLRADILLMKASRAYAAFKNCTEVTSVHLEKIAPLVLNHRGKHFPENDQTKTN
TEENNHKKEDNLNKNGSKGLNDYLLQATSTDQFLKIQIPQKESQKRTVFNSQTNQKESYN
IFKKNAISINIVNTVKKYLTTQKFKIYYKEAISESKIHLVFLIDSSSSMIKDQQISFIKG
LISETVHKFQNKKIVLSAVALQNGTATIVLKLTQNIETFIAEIQDLRSGGKTNLKAGLQL
VQQLIKSKKTKEKTLLYIITDGKINQGKTQNPFAEAVSYFKTYLKMNKNTTIIDTEKGFV
KLALAKKLANEMSVNYQTFVY
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggttaatagtatggagcaaaaaagtttcccttttacagctatctctgcacaagatgat
tttaaattggctttactcttatgtatgattgatccctcattaggaggcgttttggttcaa
ggagataaaggaacaggtaaaacaaccactgttcgtgctttacaaggtttaatgaaaaat
attgaaccccattttccttttgtcaatctaccaataggagctacagaagatcgtgtttta
ggttctattcaattagaaactctcattaacgaaaaaagattagaagtacaaaaaggatta
ctatccaaagctcatcaaggtattttatatattgatgaagtaaatttgttgaatgattat
ttaatggatgtgctattagatgcttcttcaagtggtgggtattttttagaacgagattct
atttcgcagtggcttgatagtagattttgcttagtaggcactatgaatccagaagagggc
gatttgcgtccgcaattactcgaccgttttgggttagcagttactataaaaacacctaca
gataaaaaaattcgaatggaaattgtaaatcgtcgtttgaaatttgatttagattcaaac
gaattctatcatgaatttgaagatcaagaaaaacaattagccaaccaaattacaagtgct
agaaaacaactttcaaatattcatctctcggaagaaatcagagaaacgattgcggaaaaa
tgtatagcttatcaagtagaaggattacgtgctgatattttactcatgaaagccagtcgt
gcttatgccgcttttaagaattgtacggaagtaacatctgtacatttagaaaaaatagct
cctttagttctaaatcatagagggaaacattttcctgaaaatgatcaaacaaaaacaaat
acagaagaaaataatcataaaaaggaggataacctaaataaaaatggaagtaaaggttta
aatgactatttgttacaagctacaagtacagatcagtttttaaaaattcagattccccaa
aaagaatctcaaaagagaaccgtttttaattctcaaaccaatcaaaaagagagttataat
atttttaaaaaaaacgcaataagtataaatatagtaaatacagttaaaaaatatttaact
actcaaaagtttaaaatttattacaaggaagctatctctgaatctaaaatacatttagta
tttctgattgattccagtagctcaatgattaaagatcaacaaatttcttttataaaagga
ttaatttcagaaacagtccataaatttcagaataaaaaaatagttctttcagctgtggca
ttacaaaatggtacggctacaattgttttaaaacttacacaaaatatagaaacctttatt
gcagaaatacaagatctacgatctggggggaaaacaaatttaaaagcaggcttacagtta
gtacaacaacttataaagtctaaaaaaacaaaagaaaaaactcttttatatataataaca
gatggtaaaataaatcaaggaaaaacacaaaacccatttgcagaagcggtttcatatttt
aaaacctatctaaaaatgaacaagaatacaacaataatagataccgaaaaaggttttgta
aagttagcattagccaaaaaattagctaatgaaatgagcgtaaattaccaaacctttgtt
tattaa

DBGET integrated database retrieval system