KEGG   Flavobacterium columnare: FCOL_03440Help
Entry
FCOL_03440        CDS       T01653                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
fco  Flavobacterium columnare
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    FCOL_03440
Enzymes [BR:fco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     FCOL_03440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
801164..802249
Genome map
AA seq 361 aa AA seqDB search
MTKQQIIANFDPSQPGLADATIFGLPFSAEDSEIVVIPVPWEVTVSYGAGTSEGPDAVMD
ASFQVDLNHQDFPELWKLGIYMDDAPKHWKSNSDKYKSLAQPIIEALEAGEDIETFPALQ
SDLDKINKACRELHTEVKEKVLFWMAKGKKVVLLGGDHSTPLGYYEALASKYEEYGILHL
DAHMDLRIAYEGFTYSHASIMYNALQIPQISKIVQVGIRDFCEQEVEIVHKSNGRVLVHT
DADLKEETFEGVTWAQQCSAIIASLPQKVCISFDVDGMYPWYCPNTGTPVPGGFSFEQAT
YLFNKLAESGKEIIGFDLVEVAPGEDDWDGNVGARMLFHLCGVLAKNNGMKTGNRIVFPR
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaacaaattatagccaattttgatccatcgcaaccaggattagcagatgcc
accatttttggtttgcctttttcagcggaagattccgaaattgtagtaattcctgtgcct
tgggaagtaaccgtaagttatggggcaggtacttctgaaggacctgatgccgttatggat
gcctcttttcaagtagatttaaatcaccaagactttcctgaactttggaaattaggtatt
tatatggatgatgcacctaagcattggaaatctaattctgataaatataaatcattagca
caacccataattgaggctttagaagcaggtgaagatatagaaacctttcctgccttacaa
tcggatttggataagataaataaagcctgtcgagaattgcatacagaagtaaaagaaaaa
gtacttttctggatggctaaaggaaaaaaagtagtacttttaggaggcgatcattctact
ccacttggctactatgaagcacttgcctctaaatatgaagaatacggtattttacattta
gatgcacacatggatttacgaatcgcttacgaaggttttacttattcgcatgcctctatc
atgtataacgctttacaaatcccgcaaatttctaaaattgtacaagttggtatccgtgat
ttttgtgaacaagaagtagaaattgttcataaatcaaacggtcgtgttttagtgcataca
gatgccgatttaaaagaagaaacatttgaaggggtaacttgggcacaacaatgtagtgct
attatagcttcattaccgcaaaaagtttgtatttcatttgatgtagacggaatgtatccg
tggtattgtcctaacacaggaacacccgttcctggtggattttcttttgagcaagcaacg
tatctgttcaacaaactagcagaaagcggaaaagaaattataggttttgatctagtagaa
gtagcccctggagaagatgactgggatggtaacgtaggagcacgtatgttatttcatttg
tgtggtgtattagctaaaaacaacggaatgaaaacaggaaaccgtattgtttttcctaga
aaataa

DBGET integrated database retrieval system