KEGG   Flavobacterium columnare: FCOL_03440Help
Entry
FCOL_03440        CDS       T01653                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
fco  Flavobacterium columnare
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:fco00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
801164..802249
Genome map
AA seq 361 aa AA seqDB search
MTKQQIIANFDPSQPGLADATIFGLPFSAEDSEIVVIPVPWEVTVSYGAGTSEGPDAVMD
ASFQVDLNHQDFPELWKLGIYMDDAPKHWKSNSDKYKSLAQPIIEALEAGEDIETFPALQ
SDLDKINKACRELHTEVKEKVLFWMAKGKKVVLLGGDHSTPLGYYEALASKYEEYGILHL
DAHMDLRIAYEGFTYSHASIMYNALQIPQISKIVQVGIRDFCEQEVEIVHKSNGRVLVHT
DADLKEETFEGVTWAQQCSAIIASLPQKVCISFDVDGMYPWYCPNTGTPVPGGFSFEQAT
YLFNKLAESGKEIIGFDLVEVAPGEDDWDGNVGARMLFHLCGVLAKNNGMKTGNRIVFPR
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaacaaattatagccaattttgatccatcgcaaccaggattagcagatgcc
accatttttggtttgcctttttcagcggaagattccgaaattgtagtaattcctgtgcct
tgggaagtaaccgtaagttatggggcaggtacttctgaaggacctgatgccgttatggat
gcctcttttcaagtagatttaaatcaccaagactttcctgaactttggaaattaggtatt
tatatggatgatgcacctaagcattggaaatctaattctgataaatataaatcattagca
caacccataattgaggctttagaagcaggtgaagatatagaaacctttcctgccttacaa
tcggatttggataagataaataaagcctgtcgagaattgcatacagaagtaaaagaaaaa
gtacttttctggatggctaaaggaaaaaaagtagtacttttaggaggcgatcattctact
ccacttggctactatgaagcacttgcctctaaatatgaagaatacggtattttacattta
gatgcacacatggatttacgaatcgcttacgaaggttttacttattcgcatgcctctatc
atgtataacgctttacaaatcccgcaaatttctaaaattgtacaagttggtatccgtgat
ttttgtgaacaagaagtagaaattgttcataaatcaaacggtcgtgttttagtgcataca
gatgccgatttaaaagaagaaacatttgaaggggtaacttgggcacaacaatgtagtgct
attatagcttcattaccgcaaaaagtttgtatttcatttgatgtagacggaatgtatccg
tggtattgtcctaacacaggaacacccgttcctggtggattttcttttgagcaagcaacg
tatctgttcaacaaactagcagaaagcggaaaagaaattataggttttgatctagtagaa
gtagcccctggagaagatgactgggatggtaacgtaggagcacgtatgttatttcatttg
tgtggtgtattagctaaaaacaacggaatgaaaacaggaaaccgtattgtttttcctaga
aaataa

DBGET integrated database retrieval system