KEGG   Flavobacterium columnare: FCOL_03585Help
Entry
FCOL_03585        CDS       T01653                                 

Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
fco  Flavobacterium columnare
Pathway
fco00220  Arginine biosynthesis
fco00330  Arginine and proline metabolism
fco01100  Metabolic pathways
fco01110  Biosynthesis of secondary metabolites
fco01130  Biosynthesis of antibiotics
fco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    FCOL_03585
   00330 Arginine and proline metabolism
    FCOL_03585
Enzymes [BR:fco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     FCOL_03585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase DUF4806
Motif
Other DBs
NCBI-ProteinID: AEW85557
UniProt: G8X5V4
Position
844809..845765
Genome map
AA seq 318 aa AA seqDB search
MSKSITFLINKSEIAAGTRGASLGPEAIITTARKKERYIFGENTLETIKDVNSYLDKPTK
FPFAKRIDGLLSVYEELNTKVSSLLQKKQFPIILAADHGSAGGTIAGIKSAYPDKRIGVI
WIDAHADIHTPYTTPSGNMHGMPLASVMDVDNLECQINKVDEKTIDYWNRLKNVGGVTKK
INPEDLVYIAVRDTEPQEEAVIEKLGLKWYTVQDVRNLGIWTLVNNINTQLHQCDIIYIS
FDVDSMDPLLTSHGTGTPVPHGITPQEAKDLLVHLTSNPKTICVEVVEVNPCLDEKINAM
AEIALDIVDSIVNVVKNR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtcaattacttttctaataaacaaatcagaaattgcagcaggtacacgcgga
gcttctttaggaccagaagccattatcacaacagctaggaaaaaagagcgttatattttt
ggcgaaaatactctcgaaacaattaaggatgtaaattcttatttggataagccaacgaag
tttccttttgcaaagcgtatagacggtctactttctgtttatgaggaactaaatacaaaa
gtttcttctctattacaaaaaaaacaattccctattattttagcggcagatcatggttct
gcgggtggaactatagcgggtattaagtctgcttacccagataaaagaattggagtaatt
tggattgatgctcatgcagatattcatacgccttataccacgccttcagggaatatgcac
ggaatgcctttagcctctgtaatggatgttgataacttagaatgtcaaataaataaagta
gatgaaaaaacaattgattattggaatagactaaaaaatgttggaggagtaacaaaaaaa
attaatccagaagatttagtttatatagctgtacgtgatacggaaccccaagaagaagct
gttatcgaaaagttaggtctaaaatggtatacagtacaagatgttcgtaatttggggata
tggaccttggtaaataatattaatacacaattgcatcaatgtgatataatctatatttcg
tttgatgttgattctatggatcctctcttgacttcacatggtacaggaactccagtgcct
cacggaattaccccgcaagaagcaaaagatttattagtacacttaacctctaatcctaaa
acaatttgtgtagaagtagtggaagtaaatccttgtttagatgagaaaataaacgcgatg
gcagaaatagctctagatatagtagattctattgtaaatgtggtaaaaaatagataa

DBGET integrated database retrieval system