KEGG   Flavobacterium columnare: FCOL_03585Help
Entry
FCOL_03585        CDS       T01653                                 

Definition
Arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
fco  Flavobacterium columnare
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FCOL_03585
  Amino acid metabolism
   00330 Arginine and proline metabolism
    FCOL_03585
Enzymes [BR:fco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     FCOL_03585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
844809..845765
Genome map
AA seq 318 aa AA seqDB search
MSKSITFLINKSEIAAGTRGASLGPEAIITTARKKERYIFGENTLETIKDVNSYLDKPTK
FPFAKRIDGLLSVYEELNTKVSSLLQKKQFPIILAADHGSAGGTIAGIKSAYPDKRIGVI
WIDAHADIHTPYTTPSGNMHGMPLASVMDVDNLECQINKVDEKTIDYWNRLKNVGGVTKK
INPEDLVYIAVRDTEPQEEAVIEKLGLKWYTVQDVRNLGIWTLVNNINTQLHQCDIIYIS
FDVDSMDPLLTSHGTGTPVPHGITPQEAKDLLVHLTSNPKTICVEVVEVNPCLDEKINAM
AEIALDIVDSIVNVVKNR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtcaattacttttctaataaacaaatcagaaattgcagcaggtacacgcgga
gcttctttaggaccagaagccattatcacaacagctaggaaaaaagagcgttatattttt
ggcgaaaatactctcgaaacaattaaggatgtaaattcttatttggataagccaacgaag
tttccttttgcaaagcgtatagacggtctactttctgtttatgaggaactaaatacaaaa
gtttcttctctattacaaaaaaaacaattccctattattttagcggcagatcatggttct
gcgggtggaactatagcgggtattaagtctgcttacccagataaaagaattggagtaatt
tggattgatgctcatgcagatattcatacgccttataccacgccttcagggaatatgcac
ggaatgcctttagcctctgtaatggatgttgataacttagaatgtcaaataaataaagta
gatgaaaaaacaattgattattggaatagactaaaaaatgttggaggagtaacaaaaaaa
attaatccagaagatttagtttatatagctgtacgtgatacggaaccccaagaagaagct
gttatcgaaaagttaggtctaaaatggtatacagtacaagatgttcgtaatttggggata
tggaccttggtaaataatattaatacacaattgcatcaatgtgatataatctatatttcg
tttgatgttgattctatggatcctctcttgacttcacatggtacaggaactccagtgcct
cacggaattaccccgcaagaagcaaaagatttattagtacacttaacctctaatcctaaa
acaatttgtgtagaagtagtggaagtaaatccttgtttagatgagaaaataaacgcgatg
gcagaaatagctctagatatagtagattctattgtaaatgtggtaaaaaatagataa

DBGET integrated database retrieval system