KEGG   Flavobacterium columnare: FCOL_06665Help
Entry
FCOL_06665        CDS       T01653                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fco  Flavobacterium columnare
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FCOL_06665
   01230 Biosynthesis of amino acids
    FCOL_06665
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FCOL_06665
   00030 Pentose phosphate pathway
    FCOL_06665
   00051 Fructose and mannose metabolism
    FCOL_06665
   00052 Galactose metabolism
    FCOL_06665
  Energy metabolism
   00680 Methane metabolism
    FCOL_06665
Enzymes [BR:fco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FCOL_06665
Protein phosphatases and associated proteins [BR:fco01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FCOL_06665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1550246..1551235)
Genome map
AA seq 329 aa AA seqDB search
MSNKSIKKIGVLTSGGDSPGMNAAIRSVVRTCAFYNIECIGIYRGYQGMIEGDFKEMGAR
SVNHIIDKGGTILKSARSKDFRTIEGRTLAFKKIKEAQIDALVVIGGDGTFTGAEIFNKE
FNFPVMGIPGTIDNDIYGTSHTLGYDTALNTVVEAIDKIRDTASSHNRLFFVEVMGRDAG
HIALNAGIGAGAEEILIPEEDLGLDRLLESLKRSKASGKSSSIVVVSEGDKIGKNVFELK
EYVEENLPEYDVRVSVLGHMQRGGSPSCFDRVLAARLGVKAVESLLEGKSNYMVGLLEDK
VALTPLEQAIKGHSKIDQELLKVSDIMST
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaataaaagtataaagaaaataggagtcttaacctcaggtggagattccccagga
atgaatgcggcaattcgatctgttgtaagaacgtgtgccttttataatatagaatgtata
ggtatttatagaggttatcaaggaatgatagaaggagattttaaagaaatgggtgctcgt
tccgtaaaccatataatagataaaggggggacaatacttaaatctgctcgttccaaagat
tttagaaccatagaaggcagaacattagcctttaaaaaaataaaagaagcgcaaatagat
gccctagttgtaataggaggtgatggaacctttaccggtgcagaaatctttaataaagaa
tttaattttcccgtaatgggaattcccggtaccattgacaatgatatttatggtacaagt
catacattaggatatgataccgccctaaacaccgtagtagaagctattgataaaattaga
gatacagctagttcacataacaggcttttttttgtggaagtaatggggcgtgatgctggc
catattgccctaaatgcgggtataggagcgggcgcagaagaaattcttattcccgaggaa
gatttaggattagaccgattattagaatccttaaaaagaagtaaagcttcaggcaaatca
tcaagcatagtagtcgtatcagaaggagataaaataggtaaaaatgtgttcgaactaaaa
gaatatgtcgaagaaaatttaccagaatatgacgttcgagtgtctgtgttaggtcacatg
caaagaggaggttccccttcttgttttgatagagtattagcagctcgtctaggagtaaaa
gcagttgaatctcttttagaaggaaaatccaattatatggtaggattgttagaagataaa
gtagctttaacgcctttagaacaagctataaaaggtcattctaaaattgatcaagaattg
cttaaagtttcagacatcatgtctacttaa

DBGET integrated database retrieval system