KEGG   Flavobacterium columnare: FCOL_07225Help
Entry
FCOL_07225        CDS       T01653                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
fco  Flavobacterium columnare
Brite
Enzymes [BR:fco01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     FCOL_07225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1673773..1675575
Genome map
AA seq 600 aa AA seqDB search
MKRVKAVSFFFTNPIFMKNIVFLILFICSISCKKNEYRSIQSVHNTQNLLKLNFKYFANE
INTFEKITKNNATADQLRDQFKKTRLAFKKTEEFIAYYFPSSFIKINGAPIDENDLNETN
RKIEYATGFQKIEELIFQPSINKFFLSKNIEILKGHIVVLTQQINNLQLNDSNIFEIQKL
QLLRVLSLGITGFDSALALHSLPEAQSSLRGIQEVVNSFQFDKSFNTAISKAISYLKKNN
SFNTFDRAVFITQYANPIFQNIFRIQQELHIKNNPFLTAINFNKKTPFETEAYDPNYFAP
FYNKNPSKLQIHLGKQLFFDKILSGNNQISCASCHIPNQAYADHKTKAVANKTSRNTPTL
LNAGLQNTQFADNRIRYLEDQAKAVINNPDEMHGSFTLALKKLNKNQMYRNLFHKVFPSS
KNITEENLLQSIASFVRSLSKLNSKFDEYLRGKASLTIQEKKGFNLFMGKGKCATCHFFP
LFNGSIPPLYQKTESEILGVPSRIHSKQIDPDLGEYHITKAPLKKYAFKTPTVRNASITF
PYMHNGVFNTLEEVINFYNKGGGKGNGIIVEHQTLAQNPLLLSKEEMQNIIRFIQTLNNP
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagtaaaagcagtctcttttttttttactaacccaattttcatgaaaaatata
gtctttttaatcctattcatttgttctatctcctgcaaaaaaaatgaataccgatccata
caaagcgtgcataacacacaaaacctactcaaacttaatttcaagtactttgccaatgaa
ataaatacatttgaaaaaataacaaaaaacaatgcaacagcagatcaattacgagatcaa
ttcaaaaaaactcggttagcttttaagaaaacagaagaatttattgcttactattttcct
agtagttttataaaaataaacggtgctcccattgacgaaaatgatctcaacgaaaccaat
agaaaaatagaatacgctacaggatttcaaaaaattgaagaactaatattccaaccttca
attaacaaattttttttatcaaaaaacattgaaatactaaaaggccatatcgtagtatta
acccaacaaatcaacaacttacaattaaatgacagcaatatatttgaaattcaaaaatta
caattacttcgcgttctaagtttaggaattacaggttttgactccgctctagccctgcat
tcattacccgaagcacaaagttccttaagaggtattcaggaagttgttaacagttttcaa
tttgataaatcattcaatacagccattagtaaagcaatatcttacctcaaaaaaaacaat
tcgttcaacacctttgatcgtgcggtatttatcacacaatacgccaatccgatatttcaa
aatatctttcgaattcaacaagaattgcatattaaaaacaatccctttttaactgctatt
aattttaataaaaaaacgccttttgaaacagaagcgtacgacccaaactactttgctcct
ttttacaacaaaaaccctagcaaattacaaattcacttgggtaaacaacttttttttgac
aaaattttgagtggcaataatcaaataagctgcgccagttgtcacattcctaaccaggct
tatgcagaccacaaaacgaaagccgttgcaaataaaacatcacgtaatacgccaacctta
ttaaacgcaggattgcaaaacacccaatttgcagacaatcgcattcgttatttagaagat
caagccaaagccgttataaataaccccgatgaaatgcacggtagctttacattagccctt
aaaaaacttaataaaaaccaaatgtatcgaaatctttttcataaagtttttcctagttca
aaaaatataaccgaagaaaatttattacaatccattgctagttttgtcagaagtctatcc
aaactaaattctaaatttgatgaatatctaagaggaaaagcttctttaaccatacaagaa
aaaaaaggttttaatctttttatgggaaaaggaaaatgcgcaacttgtcatttctttcct
ttatttaatggcagcattcctcctttataccaaaaaacagaaagcgaaatattaggtgtt
ccctcccgtatacattcaaaacaaatagatcccgatttaggagaatatcatattacaaaa
gcaccactcaaaaaatatgcttttaaaacaccaaccgttcgtaatgcctcgattaccttt
ccttatatgcacaacggtgtttttaacacgctagaagaagtcattaatttttacaataaa
ggaggtggcaaaggaaacggaatcatagtagaacaccaaactttagcccaaaatccgctc
cttttatctaaagaagaaatgcaaaacataattcgttttatacaaaccttaaacaatcca
tag

DBGET integrated database retrieval system