KEGG   Flavobacterium columnare: FCOL_07515Help
Entry
FCOL_07515        CDS       T01653                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
fco  Flavobacterium columnare
Pathway
fco00790  Folate biosynthesis
fco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FCOL_07515
Enzymes [BR:fco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     FCOL_07515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AEW86322
UniProt: G8X6W1
Position
complement(1738639..1739466)
Genome map
AA seq 275 aa AA seqDB search
MQMATINCKGKLVDLRKPKVMGILNITPDSFYDGGKLKTDLFVLEQAEKMVLDGAFFLDV
GGQSTRPNAPFLSADEELGRIEEIVLLLIAKFPDVLVSIDTFHSKVADECLQIGASLIND
ISAGGLDANMFRVIAKHNVPFVMMHLKGTPKTMQQMVDYDDLLKEILFYFSEKIAKARSY
GINDLILDPGFGFSKTFEQNFELLSKMELLSIAELPILVGMSRKSMIYKTLDLTAQEALN
GTTVLNTIAITKGASILRVHDVKEAVEAIRLCEMI
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatggctacgataaactgtaaaggaaaactggttgatttaaggaagcccaaagta
atgggaattttaaatataacgcctgattctttttatgatggaggaaagttaaaaacggat
cttttcgttttagaacaagctgaaaaaatggtacttgatggtgctttttttttagatgta
ggagggcaatcaacaagacctaatgctccgtttttgtccgcagatgaagaattgggtagg
atagaggaaatcgttttgcttttgatagctaagtttccagatgtattagtgtctattgat
acctttcatagtaaagtagctgatgagtgtttgcaaataggggcttctttgattaatgat
atttcagccggtggattagatgcgaatatgtttcgtgttattgctaaacataatgtgcca
tttgttatgatgcatttgaaagggactcctaagacaatgcagcaaatggtggattatgat
gatttgcttaaggaaattttgttttatttttcggaaaaaatagcaaaggcaaggagttat
ggtattaacgatttgattcttgatcctggttttgggttttctaaaaccttcgagcaaaat
tttgaattattatctaaaatggaacttctatctatagctgaattacctattcttgtaggg
atgtctagaaaatcaatgatttataaaacattagatcttacagcacaagaagcattaaat
gggactactgttttaaatacgattgcaataactaaaggggcttctattttgcgggtacat
gatgtgaaggaagcagtggaggctattagactttgtgaaatgatatga

DBGET integrated database retrieval system