KEGG   Flavobacterium columnare: FCOL_07535Help
Entry
FCOL_07535        CDS       T01653                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fco  Flavobacterium columnare
Pathway
fco00010  Glycolysis / Gluconeogenesis
fco00051  Fructose and mannose metabolism
fco00562  Inositol phosphate metabolism
fco01100  Metabolic pathways
fco01110  Biosynthesis of secondary metabolites
fco01120  Microbial metabolism in diverse environments
fco01130  Biosynthesis of antibiotics
fco01200  Carbon metabolism
fco01230  Biosynthesis of amino acids
Module
fco_M00002  Glycolysis, core module involving three-carbon compounds
fco_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FCOL_07535 (tpiA)
   00051 Fructose and mannose metabolism
    FCOL_07535 (tpiA)
   00562 Inositol phosphate metabolism
    FCOL_07535 (tpiA)
Enzymes [BR:fco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FCOL_07535 (tpiA)
Exosome [BR:fco04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FCOL_07535 (tpiA)
  Exosomal proteins of bladder cancer cells
   FCOL_07535 (tpiA)
  Exosomal proteins of melanoma cells
   FCOL_07535 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEW86326
UniProt: G8X6W5
Position
1741804..1742553
Genome map
AA seq 249 aa AA seqDB search
MRQKIVAGNWKMNKNAKQTQELIADLIINLPKTDAKIIIAPTFINLTQAVEQTKGTSIEV
VAQNMHQAEGGAFTGEISADMLTNIGIQTVILGHSERRAYFHETDALLANKVNTALKHEM
KIIFCFGEELKHRQNTQHFNIVEYQLKDALFHLNASDWKNIILAYEPVWAIGTGETASPE
QAQEMHKFIRQTILERYGNEVAENVSILYGGSVKPENAKEIFSQPDVDGGLIGGASLTTN
DFINIIKGI
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagacaaaaaatagtagctggtaattggaaaatgaataaaaatgctaaacaaacacaa
gaattgatagcggacttaattataaatcttccaaaaacagacgctaaaatcatcatagcc
cctacttttattaacttaactcaagctgtagaacaaactaaagggacttctatagaagtt
gttgctcaaaatatgcaccaagcagaaggcggtgcttttacaggagaaatatccgctgat
atgctaacaaatattgggattcaaaccgttattttaggacattctgaacgtcgtgcttat
tttcatgaaaccgatgctttattagccaataaagtaaacacagcactaaagcacgaaatg
aaaattattttctgctttggggaagaattaaaacaccgtcaaaacacacaacattttaat
atagtagaataccaattaaaagacgctctattccatttaaatgcttctgattggaaaaat
ataattttagcttacgaacccgtttgggccattggcacaggagaaacagcttctcctgaa
caagcacaagaaatgcataaattcatccgacaaacaattctagaacgttacggaaatgag
gttgcagaaaatgtttccattttatacggaggaagcgttaaaccagaaaatgccaaagaa
attttttctcaacctgacgttgatggaggtttaataggaggagcctctttaaccacaaat
gattttataaatattataaaaggaatataa

DBGET integrated database retrieval system