KEGG   Flavobacterium columnare: FCOL_07535Help
Entry
FCOL_07535        CDS       T01653                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fco  Flavobacterium columnare
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FCOL_07535 (tpiA)
   01230 Biosynthesis of amino acids
    FCOL_07535 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FCOL_07535 (tpiA)
   00051 Fructose and mannose metabolism
    FCOL_07535 (tpiA)
   00562 Inositol phosphate metabolism
    FCOL_07535 (tpiA)
Enzymes [BR:fco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FCOL_07535 (tpiA)
Exosome [BR:fco04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FCOL_07535 (tpiA)
  Exosomal proteins of bladder cancer cells
   FCOL_07535 (tpiA)
  Exosomal proteins of melanoma cells
   FCOL_07535 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1741804..1742553
Genome map
AA seq 249 aa AA seqDB search
MRQKIVAGNWKMNKNAKQTQELIADLIINLPKTDAKIIIAPTFINLTQAVEQTKGTSIEV
VAQNMHQAEGGAFTGEISADMLTNIGIQTVILGHSERRAYFHETDALLANKVNTALKHEM
KIIFCFGEELKHRQNTQHFNIVEYQLKDALFHLNASDWKNIILAYEPVWAIGTGETASPE
QAQEMHKFIRQTILERYGNEVAENVSILYGGSVKPENAKEIFSQPDVDGGLIGGASLTTN
DFINIIKGI
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagacaaaaaatagtagctggtaattggaaaatgaataaaaatgctaaacaaacacaa
gaattgatagcggacttaattataaatcttccaaaaacagacgctaaaatcatcatagcc
cctacttttattaacttaactcaagctgtagaacaaactaaagggacttctatagaagtt
gttgctcaaaatatgcaccaagcagaaggcggtgcttttacaggagaaatatccgctgat
atgctaacaaatattgggattcaaaccgttattttaggacattctgaacgtcgtgcttat
tttcatgaaaccgatgctttattagccaataaagtaaacacagcactaaagcacgaaatg
aaaattattttctgctttggggaagaattaaaacaccgtcaaaacacacaacattttaat
atagtagaataccaattaaaagacgctctattccatttaaatgcttctgattggaaaaat
ataattttagcttacgaacccgtttgggccattggcacaggagaaacagcttctcctgaa
caagcacaagaaatgcataaattcatccgacaaacaattctagaacgttacggaaatgag
gttgcagaaaatgtttccattttatacggaggaagcgttaaaccagaaaatgccaaagaa
attttttctcaacctgacgttgatggaggtttaataggaggagcctctttaaccacaaat
gattttataaatattataaaaggaatataa

DBGET integrated database retrieval system