KEGG   Flavobacterium columnare: FCOL_09415Help
Entry
FCOL_09415        CDS       T01653                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fco  Flavobacterium columnare
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FCOL_09415
Enzymes [BR:fco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     FCOL_09415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2207285..2207962)
Genome map
AA seq 225 aa AA seqDB search
MKIVRVLSTKKLLLNQKKLLLNDNLAVIERDFIKIKTKKVVIKKVADALIFTSQNAVLAV
LNSEDINFFKSKKIFCVGIKTKTLLEKKGFIVEKHTNYAEELAEIISLNYHHLSYTFFSG
NLRRDVLPKKLKEFGIAFNEIEVYKTVIASKLNNITVDSILFYSPSGVESYLKKNKITNE
VCFCIGNTTAKALENITKKIVIADQPSVENVIIKCLNYYKTPNRF
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagtgcgagtgttatccacaaaaaaactacttcttaatcaaaaaaaattattg
ctaaatgacaacttagcagttattgaaagggattttattaaaattaaaacaaaaaaagta
gttattaaaaaagtagcagatgctcttattttcacgagtcaaaatgccgttcttgccgtt
ttaaattccgaagatattaatttttttaagagtaaaaagattttttgtgtaggaataaaa
acaaaaacattattggaaaaaaaaggatttattgtcgaaaaacacacaaattatgcggaa
gaattagccgaaattatttcgttgaattatcatcatttaagttatacctttttcagtgga
aatttaagacgagatgtattgcctaaaaaattaaaagaattcgggatagctttcaatgaa
atagaagtatataaaaccgttatagcgtccaaactaaacaacatcacggtagacagcatc
ttattttacagtccatcaggagtagaaagctatttaaaaaaaaataaaattacaaatgaa
gtttgtttttgtattggtaacaccaccgcaaaagcattagaaaatataacaaaaaaaatc
gtaattgctgatcagccctcagttgaaaatgtaattattaaatgtttaaattattataaa
acacctaacaggttttaa

DBGET integrated database retrieval system