KEGG   Flavobacterium columnare: FCOL_09580Help
Entry
FCOL_09580        CDS       T01653                                 

Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fco  Flavobacterium columnare
Pathway
fco00020  Citrate cycle (TCA cycle)
fco00310  Lysine degradation
fco01100  Metabolic pathways
fco01110  Biosynthesis of secondary metabolites
fco01120  Microbial metabolism in diverse environments
fco01130  Biosynthesis of antibiotics
fco01200  Carbon metabolism
Module
fco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FCOL_09580
  Amino acid metabolism
   00310 Lysine degradation
    FCOL_09580
Enzymes [BR:fco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FCOL_09580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: AEW86725
UniProt: G8XBE5
Position
complement(2245903..2247114)
Genome map
AA seq 403 aa AA seqDB search
MILEMKVPSPGESIKEVEIATWLVQDGDYVEKDQAIAEVDSDKATLELPAEMSGIITLKA
EEGDTVAVGAVVCLIDTSAAKPEGGAAPVAENKEEAPKAEAPKAAPVQTTTYATGSASPA
AKKILAEKEIDPTTVTGTGKAGRITTEDALNAKASMGTPTGGSRGSQRTKLSMLRRKVAE
RLVSAKNETAMLTTFNEVDMSAIYALRDEYKEEFKAKHQMGLGFMSFFTKAVTRALQLFP
DVNSMIDGQEKVSFDFCDISVAVSGPKGLMVPVVRNAENLTFRGVEAEIKRLAIRARDGQ
ITVDEMTGGTFTISNGGVFGSMLSTPIINPPQSGILGMHNVVDRAIVKNGQIVIAPVMFV
ALSYDHRIIDGRESVGFLCAVKEALENPAEILMGGNPRKALEL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgattttagaaatgaaagtcccttcgccaggggaatcaatcaaggaagtggaaattgct
acttggttagtacaagacggagattatgtagaaaaagaccaggcgattgctgaggttgat
tcagataaggcaacattagaattaccagctgaaatgagcggaatcatcacgcttaaagct
gaagaaggtgacacagtagctgtaggcgcagtagtttgtttaattgatacaagcgcagca
aaaccagaaggtggagcggctcctgtagctgagaacaaagaagaagctccaaaagcggag
gctccaaaagcagcacctgttcaaacaacaacgtatgcaacaggttcggcttcgccagca
gctaaaaaaatattagcagaaaaagaaattgaccctacaacagttactggtactggtaaa
gcaggtcgtattactaccgaggacgctttaaatgcaaaagcttctatgggtactcctaca
ggaggttctcgtggctctcaaagaacaaaattatccatgttacgtcgtaaagtagcggag
cgtttagtatctgctaaaaacgaaaccgctatgttaactactttcaacgaagttgacatg
agtgctatctatgcgttacgtgacgagtataaagaagaatttaaagcaaaacaccaaatg
ggattaggcttcatgtcattctttacaaaagcagtaactcgtgctttacaattattccca
gatgtaaactcaatgattgacgggcaagaaaaagtgtctttcgatttttgtgatatttct
gttgcagtttcaggacctaaaggattaatggttcctgtggtacgtaatgcagaaaactta
acgttccgtggtgttgaagctgaaatcaagcgtttagccattcgcgcacgtgacggtcaa
atcacagtagatgaaatgactggtggaacattcactatctctaatggtggggtttttggt
tctatgttatctacacctatcatcaatccgccacaatcaggtatcttagggatgcacaat
gtagtggatagagctattgtaaaaaacggtcaaatcgtgattgctccagttatgtttgta
gcattgtcttacgaccaccgtatcatcgacggacgtgagtcggtaggtttcttatgtgct
gtgaaagaagctttagaaaatccagcagaaatcttaatgggtggtaatccaagaaaagct
ttggaattgtaa

DBGET integrated database retrieval system