KEGG   Flavobacterium columnare: FCOL_09580Help
Entry
FCOL_09580        CDS       T01653                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fco  Flavobacterium columnare
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FCOL_09580
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FCOL_09580
  Amino acid metabolism
   00310 Lysine degradation
    FCOL_09580
Enzymes [BR:fco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FCOL_09580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2245903..2247114)
Genome map
AA seq 403 aa AA seqDB search
MILEMKVPSPGESIKEVEIATWLVQDGDYVEKDQAIAEVDSDKATLELPAEMSGIITLKA
EEGDTVAVGAVVCLIDTSAAKPEGGAAPVAENKEEAPKAEAPKAAPVQTTTYATGSASPA
AKKILAEKEIDPTTVTGTGKAGRITTEDALNAKASMGTPTGGSRGSQRTKLSMLRRKVAE
RLVSAKNETAMLTTFNEVDMSAIYALRDEYKEEFKAKHQMGLGFMSFFTKAVTRALQLFP
DVNSMIDGQEKVSFDFCDISVAVSGPKGLMVPVVRNAENLTFRGVEAEIKRLAIRARDGQ
ITVDEMTGGTFTISNGGVFGSMLSTPIINPPQSGILGMHNVVDRAIVKNGQIVIAPVMFV
ALSYDHRIIDGRESVGFLCAVKEALENPAEILMGGNPRKALEL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgattttagaaatgaaagtcccttcgccaggggaatcaatcaaggaagtggaaattgct
acttggttagtacaagacggagattatgtagaaaaagaccaggcgattgctgaggttgat
tcagataaggcaacattagaattaccagctgaaatgagcggaatcatcacgcttaaagct
gaagaaggtgacacagtagctgtaggcgcagtagtttgtttaattgatacaagcgcagca
aaaccagaaggtggagcggctcctgtagctgagaacaaagaagaagctccaaaagcggag
gctccaaaagcagcacctgttcaaacaacaacgtatgcaacaggttcggcttcgccagca
gctaaaaaaatattagcagaaaaagaaattgaccctacaacagttactggtactggtaaa
gcaggtcgtattactaccgaggacgctttaaatgcaaaagcttctatgggtactcctaca
ggaggttctcgtggctctcaaagaacaaaattatccatgttacgtcgtaaagtagcggag
cgtttagtatctgctaaaaacgaaaccgctatgttaactactttcaacgaagttgacatg
agtgctatctatgcgttacgtgacgagtataaagaagaatttaaagcaaaacaccaaatg
ggattaggcttcatgtcattctttacaaaagcagtaactcgtgctttacaattattccca
gatgtaaactcaatgattgacgggcaagaaaaagtgtctttcgatttttgtgatatttct
gttgcagtttcaggacctaaaggattaatggttcctgtggtacgtaatgcagaaaactta
acgttccgtggtgttgaagctgaaatcaagcgtttagccattcgcgcacgtgacggtcaa
atcacagtagatgaaatgactggtggaacattcactatctctaatggtggggtttttggt
tctatgttatctacacctatcatcaatccgccacaatcaggtatcttagggatgcacaat
gtagtggatagagctattgtaaaaaacggtcaaatcgtgattgctccagttatgtttgta
gcattgtcttacgaccaccgtatcatcgacggacgtgagtcggtaggtttcttatgtgct
gtgaaagaagctttagaaaatccagcagaaatcttaatgggtggtaatccaagaaaagct
ttggaattgtaa

DBGET integrated database retrieval system