KEGG   Flavobacterium columnare: FCOL_09605Help
Entry
FCOL_09605        CDS       T01653                                 

Definition
phosphodiesterase I
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
fco  Flavobacterium columnare
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FCOL_09605
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    FCOL_09605
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    FCOL_09605
Enzymes [BR:fco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     FCOL_09605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2253131..2254459
Genome map
AA seq 442 aa AA seqDB search
MKKIISFFFLFQAFSLFAQRELLQSGPMVGYCEMTEAVIWLQTTTNANVKLEYFDVSNPT
KKMFSDVYNTKKESGYTCHVILDKLEQGKKYTYQVYIDNKLIKLPYPTTFESKKLWQWRE
KAPDFTVAFGSCVYINQPEVDRPGKPYGSNYTVFTSIAAKKPNIMLWGGDNIYLREVDES
LSGLYLRYTHTRSVKEIQPLLASAQNFAIWDDHDFGPNDGDRSFNYKIHTQKAFKDFWAN
KSYGLDVSQTQGTYSTFNWGDAQFFLLDNRFFKSPNDRKTGDRTLLGKEQLEWLIDALSS
SKATFKIVVVGGQVLNSASKFENYATYPQEREYLLNEIAKNEVKGVLFLSGDRHFAELSM
LKRGNNYSLYDWTVSPLTSNPSNSGLKEENKNRVEGSMFVQHNFGLLSFTGDKDDRQVKL
SLFDHEGKELWNKVITKKELGY
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattatttcttttttctttttgtttcaagccttttcattgtttgctcaaaga
gaattactacagtcaggtcctatggtgggctattgtgaaatgacggaagctgtaatttgg
ttgcaaactacaactaatgctaatgtaaagttagagtattttgatgtttcgaatccaacg
aaaaaaatgttttcggatgtttataatacaaagaaagagtcagggtatacttgtcatgtg
attttagataaattagagcaaggaaaaaaatatacttaccaagtatacattgataacaaa
ttgataaaactaccttatccaactacttttgaatcaaagaagttatggcaatggcgcgaa
aaggcacctgattttacagttgcttttggtagttgtgtttatattaatcaacctgaagtt
gatagaccaggaaaaccgtatggaagtaattatactgtttttacgagtatagcggctaaa
aaacccaatattatgttatggggaggggataatatttatttgagagaagttgatgaaagt
ttatcaggtctttaccttcgttatacacatactcgaagtgttaaagaaattcagccattg
ttagcgagtgctcaaaattttgctatctgggatgatcatgattttggccctaatgatgga
gatagaagttttaactataaaatacatactcaaaaagcatttaaggatttttgggccaat
aaatcctatggtttagatgtgtctcaaacacaaggaacttattctacctttaattggggt
gatgcacagtttttcttgttagataatcgcttttttaagtcgcctaatgatcgtaaaaca
ggagatagaacattgttaggaaaagaacaactagaatggttgattgatgctttgtcttcc
tctaaagctacttttaagattgtagttgttggaggacaagtgctaaattcagcttcaaag
tttgaaaactatgcaacgtatcctcaggaacgagagtatttgcttaatgaaattgctaaa
aatgaagttaagggagtgttattcttgtcaggagatcgtcattttgctgaattatccatg
ttaaaacgaggaaataattattctttatacgattggaccgtttccccgttgacctctaat
ccttctaactcgggattaaaagaagaaaataagaatcgtgtagaaggaagtatgtttgtg
caacataactttggattattgtcttttacgggcgataaggatgatcgacaggttaaattg
tctttatttgatcatgaaggaaaagaattatggaataaagttattacgaaaaaggaatta
gggtattag

DBGET integrated database retrieval system