KEGG   Flavobacterium columnare: FCOL_10325Help
Entry
FCOL_10325        CDS       T01653                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fco  Flavobacterium columnare
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:fco03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2425565..2426146
Genome map
AA seq 193 aa AA seqDB search
MIAHIQGKLVEKNPTDVVIDCNGVGYLVHISLHTFGLLPSNDFVKLYTYLQVKEDSHSLY
GFMEKSEREIFKLLISVSGIGANTARTMLSSLEPKQIINALASENVATIQSIKGIGIKTA
QRAIIELKDKVLKIYEIDEVSLIPNNTNKDEALSALEVLGFVRKSAEKVVEKIITATPEA
TVENIIKQALKNL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgattgcacacatacaaggaaaattagttgaaaaaaaccctaccgacgttgtaattgac
tgcaacggggtagggtacttagttcatatatctttacatacatttggtttgttaccatcg
aacgatttcgttaaattatatacctatttacaagtaaaagaagatagtcattctttgtat
ggatttatggagaaatctgaaagggaaatttttaagttactcatttcagtgtcaggtatt
ggagctaatacagcacgaactatgctttcttcattagaacccaaacaaattattaatgct
ttggcctctgaaaatgtagcgactatccaatctataaaaggaataggtattaaaaccgct
caaagggcaataatcgaattgaaagataaagtgttaaaaatctatgaaatagatgaagtt
tcattgattccaaacaatacaaataaagatgaagcgttatctgctttagaagtgcttggt
tttgttagaaaatctgctgagaaagtagttgaaaaaattattacagctacaccagaagct
actgtggaaaatattataaaacaagctttaaaaaatttataa

DBGET integrated database retrieval system