KEGG   Flavobacterium columnare: FCOL_10870Help
Entry
FCOL_10870        CDS       T01653                                 

Definition
(GenBank) pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fco  Flavobacterium columnare
Pathway
fco00010  Glycolysis / Gluconeogenesis
fco00020  Citrate cycle (TCA cycle)
fco00620  Pyruvate metabolism
fco01100  Metabolic pathways
fco01110  Biosynthesis of secondary metabolites
fco01120  Microbial metabolism in diverse environments
fco01130  Biosynthesis of antibiotics
fco01200  Carbon metabolism
Module
fco_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FCOL_10870
   00020 Citrate cycle (TCA cycle)
    FCOL_10870
   00620 Pyruvate metabolism
    FCOL_10870
Enzymes [BR:fco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FCOL_10870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 PYNP_C
Motif
Other DBs
NCBI-ProteinID: AEW86977
UniProt: G8X6D6
Position
complement(2570513..2572141)
Genome map
AA seq 542 aa AA seqDB search
MAIVVTMPRLSDTMTEGTVATWLKKVGDKIKEGDILAEIETDKATMEFESFNSGVLLHIG
IEAGQTAPVDSLLAIIGQEGEDISTLLNGGVSEKEEPVAETNVEASTTNSISSFEIPAGV
KVVTMPRLSDTMTTGTVASWLKNIGDTIKEGDILAEIETDKATMEFESFNSGTLLYIGVQ
TGDSAPVDSILAILGPAGTDVAAILANFSTEGAVAPKTEIIQESKEEAVSAPQKEASNNT
GRIFASPLAKKIAQEKGINLASVKGTGENGRITKADVEVYNSSAVQVNLPSISATDTVAE
AVTTVAAVKPFIPAGEVYQEEVKNSQMRKVIAKRLSESKFTAPHYYLTIELDMDNAMTSR
SMINNLPNTKVSFNDMVIKASAMALKKHPQVNSQWKEEAMILNHHVNIGVAVAVEDGLVV
PVLKFADQMTLSQIGTSVKDMAGRAKIKKIQPNEMEGSTFTISNLGMFGIQSFTSIINQP
NSAILSVGAIVEKPVVKNGQIVVGNTMTVTLACDHRTVDGATGAQFLQTFKAYMENPVTM
LA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagtagttaccatgcctcgtttgagcgataccatgaccgaagggactgtggca
acatggcttaaaaaagtgggagataaaattaaagaaggagatatattggctgaaattgaa
accgataaagccactatggagtttgaatcttttaattcaggggtattattacatatagga
attgaagcaggtcaaacagctcctgtagattcattattagcaatcattggtcaagaaggc
gaagatatttcaactttattaaatgggggtgtttccgaaaaagaagaaccagttgcagaa
actaacgtagaagcatctacaacaaattctatttcttcttttgaaataccagcaggagta
aaagtagttactatgcctcgtttgagtgataccatgacaacaggtactgtggcaagttgg
ttgaaaaacataggagatactataaaagaaggcgatattttagctgaaattgaaacagat
aaagcaaccatggaatttgaatcatttaattcaggtactttattatacataggcgttcaa
acaggcgattcagctcctgtagatagtattttagcaattttaggaccagctggtacagat
gttgcagctattttagctaatttttcaactgaaggagctgttgcacctaagacagaaata
atacaagagtcaaaagaagaagccgtatcagctcctcaaaaagaggcatcaaacaataca
gggagaatttttgcctctccattagctaaaaaaatagcacaagaaaaaggaattaattta
gcttctgtaaaaggaacaggagaaaatggacgtataacaaaagcagatgttgaagtatac
aattcatcagcagttcaggtaaacctaccaagcatttctgcaacagatacagtagctgaa
gcagtaacaacagtagcagcagtaaaacctttcataccagcaggtgaggtatatcaagaa
gaagtgaaaaactcacaaatgcgtaaagtaattgcaaaacgcttatcagaatctaaattt
acagcacctcattattatctaacaattgagttagatatggataatgcaatgacatctaga
tccatgattaataatttgccaaatacaaaggtatcttttaatgatatggtgataaaagct
tctgctatggcgttgaaaaaacatccacaagtaaattcacaatggaaagaagaggctatg
atcttaaaccatcatgtgaatattggtgttgcagttgcagtagaagatggtttagtagta
ccagtattaaaatttgcggatcaaatgacactgtctcaaataggaacatcagtaaaagat
atggcaggaagagctaaaataaaaaagatacagcctaacgaaatggaaggaagtactttt
actatttctaacttaggtatgtttggaattcaatcttttacttctattattaatcaacct
aattcagctattttgtcagttggagctattgtagaaaaaccagttgttaaaaacggacaa
attgtagtaggtaacacaatgacggttactttagcatgtgatcatagaacagtagatgga
gccacaggagcacagtttttacaaacttttaaagcttatatggaaaacccagtaacgatg
ttagcgtaa

DBGET integrated database retrieval system