KEGG   Flavobacterium columnare: FCOL_10870Help
Entry
FCOL_10870        CDS       T01653                                 

Definition
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fco  Flavobacterium columnare
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:fco01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:fco00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:fco00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:fco00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2570513..2572141)
Genome map
AA seq 542 aa AA seqDB search
MAIVVTMPRLSDTMTEGTVATWLKKVGDKIKEGDILAEIETDKATMEFESFNSGVLLHIG
IEAGQTAPVDSLLAIIGQEGEDISTLLNGGVSEKEEPVAETNVEASTTNSISSFEIPAGV
KVVTMPRLSDTMTTGTVASWLKNIGDTIKEGDILAEIETDKATMEFESFNSGTLLYIGVQ
TGDSAPVDSILAILGPAGTDVAAILANFSTEGAVAPKTEIIQESKEEAVSAPQKEASNNT
GRIFASPLAKKIAQEKGINLASVKGTGENGRITKADVEVYNSSAVQVNLPSISATDTVAE
AVTTVAAVKPFIPAGEVYQEEVKNSQMRKVIAKRLSESKFTAPHYYLTIELDMDNAMTSR
SMINNLPNTKVSFNDMVIKASAMALKKHPQVNSQWKEEAMILNHHVNIGVAVAVEDGLVV
PVLKFADQMTLSQIGTSVKDMAGRAKIKKIQPNEMEGSTFTISNLGMFGIQSFTSIINQP
NSAILSVGAIVEKPVVKNGQIVVGNTMTVTLACDHRTVDGATGAQFLQTFKAYMENPVTM
LA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagtagttaccatgcctcgtttgagcgataccatgaccgaagggactgtggca
acatggcttaaaaaagtgggagataaaattaaagaaggagatatattggctgaaattgaa
accgataaagccactatggagtttgaatcttttaattcaggggtattattacatatagga
attgaagcaggtcaaacagctcctgtagattcattattagcaatcattggtcaagaaggc
gaagatatttcaactttattaaatgggggtgtttccgaaaaagaagaaccagttgcagaa
actaacgtagaagcatctacaacaaattctatttcttcttttgaaataccagcaggagta
aaagtagttactatgcctcgtttgagtgataccatgacaacaggtactgtggcaagttgg
ttgaaaaacataggagatactataaaagaaggcgatattttagctgaaattgaaacagat
aaagcaaccatggaatttgaatcatttaattcaggtactttattatacataggcgttcaa
acaggcgattcagctcctgtagatagtattttagcaattttaggaccagctggtacagat
gttgcagctattttagctaatttttcaactgaaggagctgttgcacctaagacagaaata
atacaagagtcaaaagaagaagccgtatcagctcctcaaaaagaggcatcaaacaataca
gggagaatttttgcctctccattagctaaaaaaatagcacaagaaaaaggaattaattta
gcttctgtaaaaggaacaggagaaaatggacgtataacaaaagcagatgttgaagtatac
aattcatcagcagttcaggtaaacctaccaagcatttctgcaacagatacagtagctgaa
gcagtaacaacagtagcagcagtaaaacctttcataccagcaggtgaggtatatcaagaa
gaagtgaaaaactcacaaatgcgtaaagtaattgcaaaacgcttatcagaatctaaattt
acagcacctcattattatctaacaattgagttagatatggataatgcaatgacatctaga
tccatgattaataatttgccaaatacaaaggtatcttttaatgatatggtgataaaagct
tctgctatggcgttgaaaaaacatccacaagtaaattcacaatggaaagaagaggctatg
atcttaaaccatcatgtgaatattggtgttgcagttgcagtagaagatggtttagtagta
ccagtattaaaatttgcggatcaaatgacactgtctcaaataggaacatcagtaaaagat
atggcaggaagagctaaaataaaaaagatacagcctaacgaaatggaaggaagtactttt
actatttctaacttaggtatgtttggaattcaatcttttacttctattattaatcaacct
aattcagctattttgtcagttggagctattgtagaaaaaccagttgttaaaaacggacaa
attgtagtaggtaacacaatgacggttactttagcatgtgatcatagaacagtagatgga
gccacaggagcacagtttttacaaacttttaaagcttatatggaaaacccagtaacgatg
ttagcgtaa

DBGET integrated database retrieval system