KEGG   Flavobacterium columnare: FCOL_12100Help
Entry
FCOL_12100        CDS       T01653                                 

Definition
dihydrolipoyllysine-residue(2-methylpropanoyl)tr ansferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fco  Flavobacterium columnare
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FCOL_12100
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FCOL_12100
  Amino acid metabolism
   00310 Lysine degradation
    FCOL_12100
Enzymes [BR:fco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FCOL_12100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2852743..2854029)
Genome map
AA seq 428 aa AA seqDB search
MARFELKLPKMGESVAEATVTNWLKNVGDRIEMDEAVLEIATDKVDSEVPSEVAGTLVEI
LFHKDDVVQVGQTIAIIETEGGAVIESTPKVESTHVAEVVKTVEVAKEIVASVDFSTSEK
FFSPLVKNIAKEEGISLVELETIQGTGKDGRVNKEDILNYIKNRGIQSVETSIAQTIKTT
PVVTTSVPVSVNGEDEIVEMDRMRKLISKYMVESVQTSAHVQSFIEVDVTNIVKWRDKVK
NTFEKREGEKLTFTPIFMEAVAKALRDFPGMNISVDGDCIIKKKNINLGMAAALPNGNLI
VPVIKNADQLNLVGMAKAVNDLGNRAKAGKLKPDDTQGGTYTVTNVGSFGSVFGTPIINQ
PQVGILALGAIRKVPAVIETPEGDFIGIRQKMFLSHSYDHRVVDGALGGTFVKRVADILE
AWDINREI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggtttgaattaaaactacccaaaatgggtgaaagtgttgctgaggcaacggta
accaactggttaaaaaatgtgggtgaccgcattgaaatggatgaggcagtgctagaaatt
gctaccgataaagtagatagtgaagtgcctagtgaagtagcaggaacattagttgaaatt
ttatttcacaaggacgatgtggttcaggtaggtcaaaccattgctattatagaaacagaa
ggaggggcagttatagaatcaactccaaaagtagaatcaactcatgttgcagaggttgta
aaaaccgttgaggttgctaaagaaatagtggcttcagtagatttttctacttcagaaaaa
ttcttttctccattagtgaaaaacatagctaaagaagaaggaatttcattagtagaacta
gagactatacaaggtacaggcaaagacggaagagttaataaagaagatattttaaattat
attaaaaatagaggaatacagtcagtagagacttctattgctcaaacaataaaaactacg
ccagttgttacaacatcagttcctgtttcggtaaatggagaagatgagattgtagaaatg
gatagaatgcgtaaactgatttctaagtatatggtggaatcagtgcaaacttctgctcac
gtacaatcatttatagaagtagacgtaacaaacatagtaaaatggagagataaagttaaa
aatacttttgaaaagcgagaaggggaaaaattaacttttacgccaatatttatggaggct
gttgctaaagcattacgagatttccctggaatgaatatttcagtagatggtgattgtatt
attaaaaagaaaaatattaacttaggtatggctgctgcattgcctaatggaaatctaatc
gtaccagtaattaaaaatgccgatcagctaaatctagtgggaatggctaaagctgttaat
gatttagggaaccgagcaaaagcaggtaagttaaaaccagatgatacgcaaggaggaact
tatacagttactaatgtagggtcttttggatcggtatttggaacccctattattaatcaa
ccacaagtaggtattttagctctaggagctattcgtaaagtacctgcggttattgaaaca
ccagaaggagattttattggtatcagacaaaaaatgttcctttcgcattcctacgaccat
agagtggtagatggagctctaggagggacctttgtaaaacgagtggctgatattctagaa
gcttgggatattaatagagaaatataa

DBGET integrated database retrieval system