KEGG   Flavobacterium columnare: FCOL_12900Help
Entry
FCOL_12900        CDS       T01653                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
fco  Flavobacterium columnare
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3020051..3021076)
Genome map
AA seq 341 aa AA seqDB search
MKKTVFLIPLIIFVGCKKQGQEDFSKSTENKQTKSELLIKSSSFFKSISTITEEPIPEEK
INLGKKLYFDSSLSKNGTISCNSCHNLENYGVDNKALSLGDTKKLGGRNSPSSIYASLHS
MQFWDGRAKDVEEQAGGPLLNPVEHSLPSKEFLENKLRENPEYVTLFKKVYPNEKEPITF
SNITNAIGSFERKLHPKSRFDSYLDGDEKALSDNEKEGLKSFMDNNCVMCHSGVALGGQM
IQKFGIYGSYTNLTHSKKVDKGVFERTQKTGDEFMFKVPSLRNAEKTFPYFHDGSVTSLS
EAIKIMGKIQLNKNLSEQEINNIEAFLKALTADVDPKYKKA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacagtgtttttaattcctttaataattttcgtaggatgtaagaaacaaggg
caagaagatttttctaaatccactgaaaacaaacagacaaagagtgaattattaatcaaa
tcttctagtttttttaaatccatttctacgataacagaagaacctattcctgaagaaaaa
attaatttaggaaaaaaattatattttgactcttccctttctaaaaacggaacgattagc
tgtaattcttgtcataatttagaaaattatggagttgataataaagcgttatctttgggt
gatactaaaaaattgggtggtagaaattctccttcttctatttatgcttcattacattcg
atgcaattttgggacggaagagctaaggatgtggaagagcaagcgggtggtcctttactg
aatcctgtggaacacagtcttcctagtaaagaatttctggaaaataaattacgtgaaaat
cctgagtatgtaactttatttaagaaagtctatccaaatgaaaaagaacctattactttt
tcaaatattaccaatgcaattggctcttttgaaagaaaattacatccaaaaagtaggttt
gattcatatctagatggcgatgaaaaagcattatcagataacgaaaaagaagggttaaaa
tcttttatggataataactgtgtaatgtgtcatagtggagttgctctaggaggacagatg
attcaaaaatttgggatttatggaagctatacaaacctaactcatagcaagaaggttgac
aagggagtttttgaaagaactcaaaaaacaggtgatgaattcatgtttaaagtacctagt
ttaagaaatgctgaaaaaacgtttccttactttcatgatggttcagttacttcgttatca
gaagctattaaaattatgggaaaaatacaactgaataaaaatttatcagaacaagaaatc
aataatattgaagcatttttaaaagcgcttacagcagacgtagatccaaaatataaaaaa
gcataa

DBGET integrated database retrieval system