KEGG   Flavobacterium columnare: FCOL_13470Help
Entry
FCOL_13470        CDS       T01653                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fco  Flavobacterium columnare
Pathway
fco00860  Porphyrin and chlorophyll metabolism
fco01100  Metabolic pathways
fco01110  Biosynthesis of secondary metabolites
fco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FCOL_13470
Enzymes [BR:fco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     FCOL_13470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Peripla_BP_3
Motif
Other DBs
NCBI-ProteinID: AEW87489
UniProt: G8XBS4
Position
3144448..3145197
Genome map
AA seq 249 aa AA seqDB search
MKVKTILVSQPEPKVENSPYFDLQNKHKIKVDFRPFIHVEGVPAKEVRAQKIDLNNYTAI
ILTSKNSVDHFFRVAEEMRYKVPEDLRYFCQSEAVAYYLQKYVVYRKRKIYVGQKDFADM
SSFFKKYKDEKFLLPASDKLNADVPQTLNNLKLDWTPGTFYRTVMSDLSDLKDVYYDVLA
FFSPTGIQSLFKNFPDFKQNDTRIAVFGSTTQKEAIDHGLRIDIMAPAPGVPSMTMALEK
YVAEVNKGK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaaaacgattttagtatcgcaacccgagccaaaagttgagaactcgccttat
tttgatttacaaaataaacataaaataaaagttgattttagaccctttattcatgtagaa
ggagtgcccgctaaagaggttcgcgctcaaaaaattgatttgaataattatacagcgatt
atcttaactagtaagaattctgttgatcatttttttagagtggcagaggaaatgcgttat
aaggttcctgaagatttacgttatttttgtcagtcggaggcagttgcttattacttgcag
aagtatgtggtttacagaaaaagaaagatttatgtagggcaaaaggattttgcagatatg
tcttctttttttaaaaagtataaagatgaaaaatttttgctacctgcgtctgataaacta
aatgcagatgtgcctcaaactttaaataatttaaaattagattggactccaggtaccttt
tacagaacagtaatgagtgatctatcggatctaaaagatgtatattacgatgtattagcc
ttttttagtccaacaggtattcagtcattgtttaaaaattttcctgattttaaacaaaac
gacacacgtatagcggtatttggaagcacaacccaaaaagaagctattgatcatggtttg
cgtatagatatcatggcaccagcaccaggagtgccttctatgacgatggcacttgagaaa
tatgtagccgaagtaaataaaggaaaataa

DBGET integrated database retrieval system