KEGG   Flavobacterium columnare: FCOL_13470Help
Entry
FCOL_13470        CDS       T01653                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fco  Flavobacterium columnare
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FCOL_13470
Enzymes [BR:fco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     FCOL_13470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3144448..3145197
Genome map
AA seq 249 aa AA seqDB search
MKVKTILVSQPEPKVENSPYFDLQNKHKIKVDFRPFIHVEGVPAKEVRAQKIDLNNYTAI
ILTSKNSVDHFFRVAEEMRYKVPEDLRYFCQSEAVAYYLQKYVVYRKRKIYVGQKDFADM
SSFFKKYKDEKFLLPASDKLNADVPQTLNNLKLDWTPGTFYRTVMSDLSDLKDVYYDVLA
FFSPTGIQSLFKNFPDFKQNDTRIAVFGSTTQKEAIDHGLRIDIMAPAPGVPSMTMALEK
YVAEVNKGK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaaaacgattttagtatcgcaacccgagccaaaagttgagaactcgccttat
tttgatttacaaaataaacataaaataaaagttgattttagaccctttattcatgtagaa
ggagtgcccgctaaagaggttcgcgctcaaaaaattgatttgaataattatacagcgatt
atcttaactagtaagaattctgttgatcatttttttagagtggcagaggaaatgcgttat
aaggttcctgaagatttacgttatttttgtcagtcggaggcagttgcttattacttgcag
aagtatgtggtttacagaaaaagaaagatttatgtagggcaaaaggattttgcagatatg
tcttctttttttaaaaagtataaagatgaaaaatttttgctacctgcgtctgataaacta
aatgcagatgtgcctcaaactttaaataatttaaaattagattggactccaggtaccttt
tacagaacagtaatgagtgatctatcggatctaaaagatgtatattacgatgtattagcc
ttttttagtccaacaggtattcagtcattgtttaaaaattttcctgattttaaacaaaac
gacacacgtatagcggtatttggaagcacaacccaaaaagaagctattgatcatggtttg
cgtatagatatcatggcaccagcaccaggagtgccttctatgacgatggcacttgagaaa
tatgtagccgaagtaaataaaggaaaataa

DBGET integrated database retrieval system