KEGG   Fervidicoccus fontis: FFONT_0116Help
Entry
FFONT_0116        CDS       T01936                                 

Definition
putative ATP-fructose-6-phosphate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ffo  Fervidicoccus fontis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ffo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FFONT_0116
Enzymes [BR:ffo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     FFONT_0116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(106185..107141)
Genome map
AA seq 318 aa AA seqDB search
MKSFLKSGNSGKFGVHVSVGNLNIDIISSVPELPAEDDSVKAKSLFIGAGGGALNYSVAA
SRFGHTSYLIGITTPIFSSLGFFRYLIENGVKIDNVKIVEEGSPGVSNIIHLPNEQRRII
SYRGVNNLLDDDYIARSVEKINSVDVVHFSSVKSSVALSAIKKIKEKRVLKSPIFSLDPG
TESREYEKVIGEFTGLVDVLFLNEKFARNVWGYGFADFLYDMSWKTIVALKLGERGAEAF
YEGKRTSRILKKVEYVDTTGAGDAFDAVFNCALIETRSVEESLELAVTAGALKSRNIGAS
SSPFRSEVFEKKREILLL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaagagttttttaaaatccggcaattctggaaagttcggagtgcatgtttcggtagga
aatctgaacatcgacataatttcgagcgtgcctgagcttcccgctgaagatgattccgta
aaggcgaaaagcctcttcataggggcgggaggaggcgcgctgaattattctgtggcagct
tcaaggtttggacacacctcctacttgatcggcataactacacccatcttctcatcgctg
ggatttttcagatacctgatcgaaaacggggttaagatcgataatgtaaagattgtagaa
gagggctccccgggagtttcgaacataatacacctcccaaacgagcagaggaggatcatc
tcatacaggggggtcaataacttgctggatgatgattacatagctcgctcggttgaaaaa
ataaattcggttgatgtcgtccatttttcaagcgtaaagagctccgttgctctcagcgca
attaaaaagattaaggagaagcgtgttctaaagagccccatcttttctctcgatccgggg
acagaaagcagagagtatgaaaaagtgattggcgaattcacggggcttgtagacgttctt
ttcctcaatgaaaaattcgcaaggaatgtttggggatatgggtttgcagatttcctctac
gatatgagctggaagacgatcgtggcattgaagctgggcgaaaggggggcagaagcattc
tacgagggcaaaagaacttctagaatcctgaaaaaggtggagtatgtggacaccactgga
gcgggcgacgcgttcgatgctgtattcaattgcgccctaatagagactagaagcgtagaa
gagagcttggagcttgcggtcactgcgggcgctctaaagtcaagaaacattggggcctca
tcctctccgttcagatcagaggtgtttgaaaagaagcgcgagatcctgctgctctag

DBGET integrated database retrieval system