KEGG   Fervidicoccus fontis: FFONT_0201Help
Entry
FFONT_0201        CDS       T01936                                 

Definition
Agmatinase (agmatine ureohydrolase) (speB-1)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ffo  Fervidicoccus fontis
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ffo00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
192396..193289
Genome map
AA seq 297 aa AA seqDB search
MWKLRALKKFPFGGLYKNKEETKISLIGAPLDLTNSHAPGTYLAPEAIRRIAESLEWYSL
LYEGDFSENGIYDEGDLVLFPGKVRENIDLISESLLDIKEEKRIPFMLGGEHTVTLASSK
LLDEDTLLVVFDAHFDLRDEYLNSNITHATVMRRIVDNFEPKNLLFIGTRAVSQEELDFV
KKNQIEYITSRRIWLYGISEFARNIERKLEKFGKIYVSIDIDAVDPGYAPGVSTPEPLGI
DPHMFFGLLDPLVNEKLIGLDIVEVNPIRDAGEATSALAAKIVIESAIKLNKIYNKR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaacttagagccttaaaaaaatttccctttggcggactctataaaaataaagaa
gaaacaaaaatcagcttaataggcgcaccattagatttgacaaattcacatgcaccgggt
acatatcttgcacctgaggccataaggagaattgctgaaagccttgaatggtattcgctt
ctctatgaaggagacttttctgaaaatggaatttatgatgaaggagatttggtgcttttt
cccggaaaagtgagggaaaatatagatcttatttcagagtcgctattagacattaaggaa
gaaaaaagaattccttttatgcttggcggagagcataccgtgacactcgcttcttcaaaa
ctgcttgatgaagacactttgttggttgtgttcgatgcccattttgatttgagggacgag
tatttgaattcaaacataacacacgcgacagtaatgagaagaatagttgataatttcgaa
ccaaaaaatttactttttatcggaacgagagctgtttctcaagaagaactggattttgta
aagaagaatcagattgaatatataacaagcagaaggatctggctgtatggaataagcgag
tttgcgaggaacattgaaagaaagttggaaaaatttggaaaaatttatgtttccatagat
atagatgcggtagatcctggttacgcacctggggtgagcactcctgaacctttggggata
gacccgcacatgttttttggactactggatcctcttgttaatgagaagctaataggatta
gatatagtagaagtgaatccaattagagatgcaggagaggcaacaagtgctctagcagca
aaaattgtgatagaatctgctataaagcttaataaaatctataacaaaagataa

DBGET integrated database retrieval system