KEGG   Fervidicoccus fontis: FFONT_0201Help
Entry
FFONT_0201        CDS       T01936                                 

Definition
Agmatinase (agmatine ureohydrolase) (speB-1)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ffo  Fervidicoccus fontis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ffo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    FFONT_0201
Enzymes [BR:ffo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     FFONT_0201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
192396..193289
Genome map
AA seq 297 aa AA seqDB search
MWKLRALKKFPFGGLYKNKEETKISLIGAPLDLTNSHAPGTYLAPEAIRRIAESLEWYSL
LYEGDFSENGIYDEGDLVLFPGKVRENIDLISESLLDIKEEKRIPFMLGGEHTVTLASSK
LLDEDTLLVVFDAHFDLRDEYLNSNITHATVMRRIVDNFEPKNLLFIGTRAVSQEELDFV
KKNQIEYITSRRIWLYGISEFARNIERKLEKFGKIYVSIDIDAVDPGYAPGVSTPEPLGI
DPHMFFGLLDPLVNEKLIGLDIVEVNPIRDAGEATSALAAKIVIESAIKLNKIYNKR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaacttagagccttaaaaaaatttccctttggcggactctataaaaataaagaa
gaaacaaaaatcagcttaataggcgcaccattagatttgacaaattcacatgcaccgggt
acatatcttgcacctgaggccataaggagaattgctgaaagccttgaatggtattcgctt
ctctatgaaggagacttttctgaaaatggaatttatgatgaaggagatttggtgcttttt
cccggaaaagtgagggaaaatatagatcttatttcagagtcgctattagacattaaggaa
gaaaaaagaattccttttatgcttggcggagagcataccgtgacactcgcttcttcaaaa
ctgcttgatgaagacactttgttggttgtgttcgatgcccattttgatttgagggacgag
tatttgaattcaaacataacacacgcgacagtaatgagaagaatagttgataatttcgaa
ccaaaaaatttactttttatcggaacgagagctgtttctcaagaagaactggattttgta
aagaagaatcagattgaatatataacaagcagaaggatctggctgtatggaataagcgag
tttgcgaggaacattgaaagaaagttggaaaaatttggaaaaatttatgtttccatagat
atagatgcggtagatcctggttacgcacctggggtgagcactcctgaacctttggggata
gacccgcacatgttttttggactactggatcctcttgttaatgagaagctaataggatta
gatatagtagaagtgaatccaattagagatgcaggagaggcaacaagtgctctagcagca
aaaattgtgatagaatctgctataaagcttaataaaatctataacaaaagataa

DBGET integrated database retrieval system