KEGG   Fervidicoccus fontis: FFONT_0283Help
Entry
FFONT_0283        CDS       T01936                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ffo  Fervidicoccus fontis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ffo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    FFONT_0283
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FFONT_0283
Enzymes [BR:ffo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     FFONT_0283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(268547..269506)
Genome map
AA seq 319 aa AA seqDB search
MKCLSKGVMINKDFYNQDVISIQQFTREDLETLFEYADRAKKHKDKKLELLKDKVVMLAF
FEPSTRTRFSFEVAAKRLGADVVGFSGEEGTSISKGENFTDTIRMLDSYSNLIVIRHKLE
GAAKYASEIAENPVINAGDGKQHHPTQAMIDLYTIREIFGTIDELTYAVVGDLRYGRAST
SFIYGLLIYNPKKLYLVSPPNLGAREEVISYLKEKGVAFEEIRNLEEIIDEIDVLYTIRL
QKERFPDITEYEKAKGSYKITLDLLKNAKKGLKIMHPLPKLDEIDKEIDSTEYAAYFQQA
KNGVPVRMALLSLIFGVEL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtttaagcaagggcgttatgataaataaagatttctataaccaagatgttatt
tctatacagcagttcactagagaagatttggaaacattgttcgaatatgcagacagagca
aaaaagcataaggataaaaagcttgagcttttaaaagataaagtagtcatgctggctttt
tttgagccttcgacaaggacgagattcagctttgaagttgctgcaaaaaggttgggagca
gatgtagtcggtttttctggagaagagggaacaagcataagcaaaggagaaaactttacc
gatactataagaatgcttgactcatattcaaacttgattgtaataaggcacaaactggaa
ggagcagcaaaatatgcatccgaaattgcggaaaatcctgttattaatgcgggtgatgga
aagcaacatcaccctactcaagcaatgatcgatctttatactataagagaaatttttggc
acgatcgatgagctaacttatgcagtagtaggagatttgagatatggaagagcttcaaca
tcattcatttacggccttctcatttataatcctaagaaactttacttagtttctccgccg
aatttgggcgcaagggaagaggttataagttatctaaaagaaaaaggagttgctttcgag
gaaatcagaaatttagaagaaataattgatgaaattgatgttctctatactataaggttg
caaaaagagaggtttccagatattaccgagtacgaaaaagcaaaagggtcatataaaata
acgcttgatcttttaaaaaatgcgaaaaaggggttgaaaataatgcaccccttacctaag
ctggatgagatagacaaagagatcgattctaccgaatatgccgcatattttcaacaagcc
aaaaatggagtgcctgtgaggatggctctattatcactcatctttggtgttgagctatga

  All links  
No link information was found.   
DBGET integrated database retrieval system