KEGG   Fervidicoccus fontis: FFONT_0326Help
Entry
FFONT_0326        CDS       T01936                                 

Definition
2-oxoacid:ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
ffo  Fervidicoccus fontis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ffo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FFONT_0326
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FFONT_0326
   00020 Citrate cycle (TCA cycle)
    FFONT_0326
   00620 Pyruvate metabolism
    FFONT_0326
   00640 Propanoate metabolism
    FFONT_0326
   00650 Butanoate metabolism
    FFONT_0326
  Energy metabolism
   00680 Methane metabolism
    FFONT_0326
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    FFONT_0326
Enzymes [BR:ffo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     FFONT_0326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(311445..312311)
Genome map
AA seq 288 aa AA seqDB search
MREHVLPGDAACPGCPIPIGLKTVAAAFNGNAVLVIPACCTSVVVGTYPYSSLKMNIVHT
PFASSASVASGLREALKQRGLEDTQVIVWAGDGGTADIGMASLSGAAERNEDIIYIMYDN
EAYMNTGIQRSSSTPIKAWTTTTPVYGKSEPKKDVARIMIAHNVPYVATASIAYPQDLYQ
KLKKAQEIRGFRFIQLHSPCPVGWRFDASKTVEVARLAVETGMWILYEYFDNKLRVSGPS
MPVIKEGKIKPIEDYIKIQRRFSNINGEGILEIQRMRDNNIEWIKKLL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagagagcatgttcttccaggagatgcagcttgccctggatgtccaatacccatcgga
ctaaagactgttgctgcagcatttaacggtaatgctgtcttggttatccctgcatgttgc
acatcagttgtcgttggaacatatccatatagcagtttaaaaatgaatattgttcataca
ccatttgccagttcagcaagcgtagccagcggtttgagagaagccctaaaacaaagaggc
ttagaggatacacaagttatagtttgggctggagatggtggtactgcagacattggtatg
gcatcactaagtggggctgcagaaagaaacgaagacataatatatataatgtatgataat
gaagcatatatgaatacaggaatacaaagaagcagttctacaccaataaaggcttggaca
actacaactcccgtatatggaaagagcgaacctaaaaaagatgtagcaagaataatgatt
gctcataatgttccatatgtcgctactgcaagcattgcatatccgcaagatctttatcaa
aaacttaaaaaagctcaagaaattagaggatttagatttattcagttacattctccttgt
cctgtaggatggagatttgatgcatcgaaaaccgtagaagtagcaagactggctgtagag
actggcatgtggatactctatgagtactttgataacaagttgagagtttcaggtcctagc
atgcctgtaataaaagaaggaaaaattaaacctattgaagattatattaaaatccaaaga
agatttagcaatataaacggagaagggattttagaaatccaaaggatgagagataataac
attgaatggattaaaaaattattataa

DBGET integrated database retrieval system