KEGG   Fervidicoccus fontis: FFONT_0328Help
Entry
FFONT_0328        CDS       T01936                                 

Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
ffo  Fervidicoccus fontis
Pathway
ffo00010  Glycolysis / Gluconeogenesis
ffo00020  Citrate cycle (TCA cycle)
ffo00620  Pyruvate metabolism
ffo00640  Propanoate metabolism
ffo00650  Butanoate metabolism
ffo00680  Methane metabolism
ffo00720  Carbon fixation pathways in prokaryotes
ffo01100  Metabolic pathways
ffo01120  Microbial metabolism in diverse environments
ffo01130  Biosynthesis of antibiotics
ffo01200  Carbon metabolism
Module
ffo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ffo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FFONT_0328
   00020 Citrate cycle (TCA cycle)
    FFONT_0328
   00620 Pyruvate metabolism
    FFONT_0328
   00640 Propanoate metabolism
    FFONT_0328
   00650 Butanoate metabolism
    FFONT_0328
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    FFONT_0328
   00680 Methane metabolism
    FFONT_0328
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    FFONT_0328
Enzymes [BR:ffo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     FFONT_0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_6 Fer4_21 Fer4_10 Fer4_16 Fer4_8 Fer4_2 Fer4_9 Fer4_4 Fer4_17 Fer4_3 Fer4_13 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AFH42318
UniProt: I0A011
Position
complement(313542..313838)
Genome map
AA seq 98 aa AA seqDB search
MSNLKIIPSKSKLPISYPKEGAAGKTGEWRTERPIVDIKKCTRCMLCETYCPVNAIRVEK
DTGATINYEYCKGCGICMNVCPVKAITMVPEQSSEVLK
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttaaaaattattccttcaaagagcaaattgcctatatcctatccaaaagag
ggtgcagcagggaaaacaggcgagtggaggactgaaagaccaatagttgatatcaaaaaa
tgcacaagatgcatgctttgcgaaacttattgccctgtaaacgctattagggtcgaaaaa
gacacaggagcgacaataaattacgaatattgcaagggatgcggaatctgcatgaatgtc
tgcccagtaaaagcaattactatggttccagaacaatcttcagaggtgttaaaatga

DBGET integrated database retrieval system