KEGG   Fervidicoccus fontis: FFONT_0365Help
Entry
FFONT_0365        CDS       T01936                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ffo  Fervidicoccus fontis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ffo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FFONT_0365
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FFONT_0365
   00640 Propanoate metabolism
    FFONT_0365
   00660 C5-Branched dibasic acid metabolism
    FFONT_0365
Enzymes [BR:ffo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     FFONT_0365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(347681..348835)
Genome map
AA seq 384 aa AA seqDB search
MIKVKLFEYEAKEIYKLHGIKVPKGVVIAKSDDIEKKIEESKLKFPLVVKSQVLVAGRGK
SGGVKFAKDINEAVTVSNNLFNLEIKGLKPNFLLIEEAVEHDNEYFASITIDRAERCPVI
LVSKSGGMEIEEVSKKSPESIIKYHVDPILGMRDFEARNIGYKLGLSGKELASFTSFLKS
LYNIFEMYDGDLVESNPFTIVNGEVIALDSRIIIDDNSVYKHKELVANKEMSGEETEWEI
RAKQRGFAFVELDGNIGIIGNGAGLTMATMDLIYEFGGSPANFLDIGGGANSERVKEAVS
LLLEYPKAKSIFINIFGGITRCDEVARGIEGALKSVGKIKPIFVRLSGTNEEEGKRILKE
LGISSYNDPIEAARSTVNSVKGGE
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgataaaagtgaagctttttgaatatgaagcaaaggaaatttacaaattgcacggtatt
aaggttcctaagggggtcgtcattgcaaaaagtgatgatatagaaaagaagattgaagag
agcaaactgaaattcccattagttgtaaaaagccaagttttggttgcaggaagaggaaag
tcaggaggagtaaaatttgctaaagatattaacgaagctgttacagtttcgaacaatctg
tttaatttagaaattaaaggactaaaaccgaatttcctgcttattgaagaagcagtagaa
catgataatgagtatttcgcttctataactatcgatagagccgaaagatgcccagttata
ttagtaagcaaaagcggcggtatggaaattgaagaagtctctaaaaaaagcccggaaagc
attataaaatatcatgttgacccgatccttggtatgagagatttcgaagcaagaaatata
ggatataagctaggtctgagtggaaaagagctagctagcttcacatcatttctgaagagc
ctatataacatttttgaaatgtatgatggagatttagtcgagagcaatccattcactatt
gtaaacggagaagttatagctttagattcgagaattataatagacgataattctgtctat
aagcataaggaacttgttgcgaacaaagaaatgagcggtgaagaaactgaatgggagatc
agagctaaacaaagaggctttgcatttgtcgagttagatgggaatattgggattatagga
aacggtgcaggactaacaatggcaactatggatttgatttatgagttcggtgggagtcct
gcgaattttcttgatataggcggtggagctaattcagaaagagtgaaggaggctgtttct
ctcttgcttgaataccctaaagctaaaagtatatttatcaatatatttggaggaataacc
aggtgcgatgaagtagctagaggaatagaaggagcattgaagtctgttggtaaaattaag
ccgattttcgtcaggctttcaggcacaaatgaagaggaagggaaaaggatacttaaagag
ttgggaataagttcatataatgatccaattgaagctgcgagaagcactgtcaattctgta
aagggaggtgaataa

DBGET integrated database retrieval system