KEGG   Fervidicoccus fontis: FFONT_0365Help
Entry
FFONT_0365        CDS       T01936                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ffo  Fervidicoccus fontis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ffo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FFONT_0365
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FFONT_0365
   00640 Propanoate metabolism
    FFONT_0365
   00660 C5-Branched dibasic acid metabolism
    FFONT_0365
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    FFONT_0365
Enzymes [BR:ffo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     FFONT_0365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(347681..348835)
Genome map
AA seq 384 aa AA seqDB search
MIKVKLFEYEAKEIYKLHGIKVPKGVVIAKSDDIEKKIEESKLKFPLVVKSQVLVAGRGK
SGGVKFAKDINEAVTVSNNLFNLEIKGLKPNFLLIEEAVEHDNEYFASITIDRAERCPVI
LVSKSGGMEIEEVSKKSPESIIKYHVDPILGMRDFEARNIGYKLGLSGKELASFTSFLKS
LYNIFEMYDGDLVESNPFTIVNGEVIALDSRIIIDDNSVYKHKELVANKEMSGEETEWEI
RAKQRGFAFVELDGNIGIIGNGAGLTMATMDLIYEFGGSPANFLDIGGGANSERVKEAVS
LLLEYPKAKSIFINIFGGITRCDEVARGIEGALKSVGKIKPIFVRLSGTNEEEGKRILKE
LGISSYNDPIEAARSTVNSVKGGE
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgataaaagtgaagctttttgaatatgaagcaaaggaaatttacaaattgcacggtatt
aaggttcctaagggggtcgtcattgcaaaaagtgatgatatagaaaagaagattgaagag
agcaaactgaaattcccattagttgtaaaaagccaagttttggttgcaggaagaggaaag
tcaggaggagtaaaatttgctaaagatattaacgaagctgttacagtttcgaacaatctg
tttaatttagaaattaaaggactaaaaccgaatttcctgcttattgaagaagcagtagaa
catgataatgagtatttcgcttctataactatcgatagagccgaaagatgcccagttata
ttagtaagcaaaagcggcggtatggaaattgaagaagtctctaaaaaaagcccggaaagc
attataaaatatcatgttgacccgatccttggtatgagagatttcgaagcaagaaatata
ggatataagctaggtctgagtggaaaagagctagctagcttcacatcatttctgaagagc
ctatataacatttttgaaatgtatgatggagatttagtcgagagcaatccattcactatt
gtaaacggagaagttatagctttagattcgagaattataatagacgataattctgtctat
aagcataaggaacttgttgcgaacaaagaaatgagcggtgaagaaactgaatgggagatc
agagctaaacaaagaggctttgcatttgtcgagttagatgggaatattgggattatagga
aacggtgcaggactaacaatggcaactatggatttgatttatgagttcggtgggagtcct
gcgaattttcttgatataggcggtggagctaattcagaaagagtgaaggaggctgtttct
ctcttgcttgaataccctaaagctaaaagtatatttatcaatatatttggaggaataacc
aggtgcgatgaagtagctagaggaatagaaggagcattgaagtctgttggtaaaattaag
ccgattttcgtcaggctttcaggcacaaatgaagaggaagggaaaaggatacttaaagag
ttgggaataagttcatataatgatccaattgaagctgcgagaagcactgtcaattctgta
aagggaggtgaataa

DBGET integrated database retrieval system