KEGG   Fervidicoccus fontis: FFONT_0402Help
Entry
FFONT_0402        CDS       T01936                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ffo  Fervidicoccus fontis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ffo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FFONT_0402
   00030 Pentose phosphate pathway
    FFONT_0402
   00051 Fructose and mannose metabolism
    FFONT_0402
   00052 Galactose metabolism
    FFONT_0402
   00500 Starch and sucrose metabolism
    FFONT_0402
   00520 Amino sugar and nucleotide sugar metabolism
    FFONT_0402
  Nucleotide metabolism
   00230 Purine metabolism
    FFONT_0402
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FFONT_0402
Enzymes [BR:ffo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     FFONT_0402
    5.4.2.8  phosphomannomutase
     FFONT_0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(380205..381563)
Genome map
AA seq 452 aa AA seqDB search
MGKIFGTDGIRLKVKNELQAEFLVKISQAICEEFGERSVFLLGRDVRYGGELIRHAIISG
FLTSGCRVYDAGLITTPALQYVIKNEGFFDGGVMITASHNPPEYNGIKVIDSDGIEIPRE
KENEIEKIYLENRISGKISSEEKFFIPKYPDPLDKYLEGILDNVDDEIIKRRNFKVVVDG
ANSVGSLVIPKLVKLLGGKPISLNSHLDPDFSGRLPEPTPETLFDTSNVVKAVNADLGIA
VDGDADRSIFLDEFGNVLWGDKTAVILSIYLSEKNPELPKKVYTGISSSYFIEELLKKRG
IDVIWMKVGSVDIARKLKKEGGLLGFEENGGIMYPKHQYVRDAGMALALMLEVMSAERKK
ISELYSIYPKTYTIKTKYSIDISKAKEIIEKIKNCYRSYPMIDIDGVKVLQEDSWFLVRP
SGTEPVLRVMVESKIQNKEKLILKELEKIILG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagatttttggaaccgatggtataagattaaaagttaaaaatgaacttcaagct
gaatttttggtgaaaatatcgcaagctatatgtgaagaatttggagaaagatctgtgttc
ttgctagggagagacgttaggtatggcggagaactgataagacatgcaataatctctgga
tttttaacttcagggtgtagggtttacgacgcaggattaatcaccacaccagctttacag
tatgttataaaaaatgaaggtttttttgacggaggtgtgatgattactgcaagtcacaat
ccacccgaatataatggtataaaggttattgatagcgatggaattgaaataccgagagag
aaagaaaatgaaatagaaaaaatatatttagaaaacagaatttccggaaagatatcttca
gaagaaaagttctttattccgaagtacccagatccgcttgataagtacttggaagggata
ttagataatgttgacgatgagattataaaaagaagaaattttaaagttgttgtagatgga
gcaaatagcgttggttctttagttattccaaagcttgtaaagctccttggaggaaagccc
ataagtttaaattctcacctcgatccggatttttcaggcagactccctgagccaactccc
gaaactctttttgatacttccaatgttgtaaaagcagtgaatgcagatttaggaatagct
gttgacggagatgcagatagatcgatttttcttgatgaatttggaaacgttctgtgggga
gataaaacagcagtcattctgtcaatatatctctcggaaaaaaacccggagcttccaaag
aaagtatatacaggaatcagcagtagctattttattgaggagttgcttaaaaagcgcgga
atagacgtcatttggatgaaggttggtagcgtcgatatcgctaggaaactaaaaaaagag
ggtgggcttttgggattcgaggagaatggcggaattatgtatccaaaacatcagtatgta
agagatgcaggtatggcattagctctaatgcttgaagttatgtcagcagaaagaaaaaaa
atatcagaattatattctatctatccaaagacttatacaataaaaacaaaatacagtatt
gatataagtaaagctaaggaaattatagaaaaaataaaaaattgttatagaagttatcca
atgattgatattgatggtgtaaaagttttacaggaagattcgtggtttctcgtaagacct
agtggtacggaacccgtattaagagtaatggttgagtctaaaatacaaaacaaggaaaag
cttattttaaaagaacttgaaaaaattatcctcggttga

DBGET integrated database retrieval system